KEGG   Homo sapiens (human): 26084
Entry
26084             CDS       T01001                                 

Gene name
ARHGEF26, CSGEF, HMFN1864, SGEF
Definition
(RefSeq) Rho guanine nucleotide exchange factor 26
  KO
K13744  Rho guanine nucleotide exchange factor 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01133  Salmonella SopB to RhoG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26084 (ARHGEF26)
   05100 Bacterial invasion of epithelial cells
    26084 (ARHGEF26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26084 (ARHGEF26)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Others
    26084 (ARHGEF26)
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    26084 (ARHGEF26)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_9 SH3_2 PH IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 26084
NCBI-ProteinID: NP_001238891
OMIM: 617552
HGNC: 24490
Ensembl: ENSG00000114790
Vega: OTTHUMG00000159098
Pharos: Q96DR7(Tbio)
UniProt: Q96DR7 A0A140VJU4 B3KXG0
Position
3q25.2
AA seq 871 aa
MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLL
AAQIPAQVPTASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAV
PGGSPKSPANGAVTLPAPPPPPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAA
NNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSP
AALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDN
DVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMEDKEKFSSLGRI
KKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTER
HHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQ
RTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDS
PKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRG
ELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNE
ELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHS
SGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF
PMECAKEITCQATIDKNVERMGRLLGLETNV
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggacggcgagagcgaggtggatttttctagcaacagcataacccctttgtggcggagg
cggtcgattcctcagccccaccaggttctgggccggagcaagccgaggccccagtcctac
cagagccccaacgggttactaattacggatttcccggtggaggacggagggacgctcctc
gcagcgcagattcccgcccaggtgcccaccgcctcggacagcaggacggtacataggagc
cccctgcttctgggcgcccagcggagagcggtggccaatggtgggacggcatccccggag
tacagggctgcctctcctcgacttcgacggcccaagtcacccaagctccccaaagcggtg
cctggcggctccccgaaatccccagcaaatggcgcggtgaccttgcctgcgccgccgccg
ccgccggttctgcgccccccgcggactcctaacgcgcccgccccctgcacccccgaggag
gaccttactgggttgactgccagcccggtgccttcgcccactgcaaatggccttgccgct
aataacgactctcctgggtcaggttcgcagtccggccggaaggcaaaggaccccgaacgg
gggctctttcctgggccccagaaaagttcttcggaacaaaaactccccctccaaaggctg
ccctcccaggagaacgagctcctcgagaatccttccgtggttttgagtacaaacagcccc
gccgccctcaaagtggggaagcagcagatcattccgaagagtctggcctcggaaattaaa
ataagtaaatccaacaatcaaaatgtggagccccacaagagactcctcaaggtgcgcagc
atggtggagggcctaggaggacccctgggtcacgcaggggaggagagtgaggtcgataac
gacgtggatagcccagggtctctgcggagaggcttgcggtccacgtcttatcgcagggca
gtggtcagtggctttgattttgacagtcctaccagctcgaagaagaagaacagaatgtcc
cagcctgttctgaaagtggtgatggaagacaaggagaagttttccagtctgggaaggata
aagaaaaaaatgctgaaaggacaaggaacatttgatggggaagaaaatgctgtcctgtat
caaaactacaaggaaaaggcccttgacattgattctgatgaagagtcagagcccaaagaa
cagaagtcagatgaaaaaattgtgattcaccataagccattgagatccacatggagccaa
ctctctgcggtgaaaagaaagggattatctcagacagtaagccaggaggaaagaaagaga
caagaggctatctttgaagtcatatcctctgaacattcatatttactcagcttggagatc
ttgatacgaatgtttaaaaattctaaagaactgagtgatacaatgactaaaaccgagagg
caccatcttttctccaatattacagatgtctgtgaggcaagcaaaaagttctttatagag
ttggaagcaagacatcagaataatatcttcatagatgacataagtgacattgtggaaaaa
cacacagcatccacatttgacccatatgtgaaatactgcacaaatgaagtctaccaacaa
cgaacactacaaaaattgttagctaccaatccatcctttaaggaagtattgtcaaggatt
gagtcccatgaagactgtaggaacttacccatgatctcttttctcattctccccatgcag
agggtgacccgccttcccctgctgatggatactatctgtcaaaaaacacctaaggactct
ccgaagtatgaagtctgcaaaagagccttgaaggaagttagcaagttggttcgactatgc
aatgagggcgcccggaagatggaaaggactgagatgatgtacacaattaactcccagctg
gaatttaaaattaagccttttcctttagtctcctcttcccggtggttggtaaaaagaggt
gaattgacagcctatgttgaagacactgtgcttttctcaagaaggacatccaaacagcaa
gtctacttctttctctttaacgatgtgctcattatcaccaagaagaagagtgaagaaagt
tacaacgtcaatgattattccttaagagatcagctattggtggaatcttgtgacaatgaa
gagcttaattcttctccagggaagaacagctccacaatgctctattcaagacagagctct
gccagtcacctctttactctgacagtccttagtaaccacgcgaatgagaaagtggagatg
ctactaggagctgagacgcagagcgagcgagcccgctggataactgccctgggacacagc
agcgggaagccgcctgcagaccgaacctcactgacccaggtggaaatcgttaggtcattt
actgctaagcagccagatgaactctccctgcaggtggctgacgtcgtcctcatctatcaa
cgtgtcagcgatggctggtatgagggggaacgactacgagatggagaaagaggctggttt
cctatggaatgtgccaaggagataacatgtcaagctacaattgataagaatgtggagaga
atgggacgcttgctaggactggagaccaacgtgtag

DBGET integrated database retrieval system