KEGG   Homo sapiens (human): 26088
Entry
26088             CDS       T01001                                 
Symbol
GGA1
Name
(RefSeq) golgi associated, gamma adaptin ear containing, ARF binding protein 1
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    26088 (GGA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26088 (GGA1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   GGA
    26088 (GGA1)
SSDB
Motif
Pfam: VHS Alpha_adaptinC2 GAT GGA_N-GAT Maestro_HEAT Elf4 MIF4G Ferritin RasGEF_N_2 AP3B1_C MCPsignal COG4_N PCRF
Other DBs
NCBI-GeneID: 26088
NCBI-ProteinID: NP_037497
OMIM: 606004
HGNC: 17842
Ensembl: ENSG00000100083
UniProt: Q9UJY5
Structure
Position
22:37608834..37633564
AA seq 639 aa
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLAR
LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGA
AAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRG
EEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDE
LMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL
DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVS
PEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDV
LVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLAN
PQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggagcccgcgatggagccggagactctggaggcgcgaatcaatagagccacgaacccc
ctgaacaaggagctcgactgggccagcatcaacggcttctgcgagcagctcaacgaggac
tttgaggggcctccactcgccacccggctgctggcccacaagatccagtccccacaggag
tgggaggcgatccaggccttgacggtgctggaaacatgcatgaagagctgcggcaagcgg
ttccacgacgaagtgggcaagttccgctttctcaacgagctcatcaaggtcgtgtctccc
aagtatctgggctctcggacatcggagaaggtgaagaacaagatcttggagctcctctac
agctggacagtgggcctgcccgaggaggtgaaaatcgcagaggcctaccagatgctaaag
aagcaggggattgtaaagtccgaccccaagcttccagatgacactacctttccccttcct
cctccacggccgaagaatgtgatctttgaagatgaggagaaatccaagatgctggcccgc
ctgctgaagagctcccatcccgaagacctccgcgcagccaataagctcatcaaagagatg
gtgcaggaggaccagaagcggatggagaagatctcgaagagggtgaatgccatcgaggag
gtgaacaacaatgtgaaactgctcacggagatggtgatgagccacagccagggcggcgca
gcagctggcagcagcgaggacctcatgaaggaactgtaccagcgctgtgagcggatgcgg
cccacgctcttccgactggcgagtgacacagaggacaatgatgaggccttagcggagatc
ctgcaggccaatgacaacctcacccaggtgatcaacctgtataagcagctggtgcggggt
gaggaggtcaacggtgatgccacagccggctccatccctgggagcacctcggccctgctg
gatctctcaggcctggatctcccgcctgcgggcaccacctacccagctatgcccacccgc
cctggcgagcaggccagccctgagcagcccagtgcctcagtttccctgcttgacgacgag
ctcatgtctctgggcctcagtgaccccacacccccttcaggcccaagcctggatggtacc
ggatggaacagcttccagtcgtcggatgccactgagcccccagcccctgctctggcccag
gcccccagtatggaaagccgacccccagcgcagacatccctgccagcaagcagcggtctg
gacgacctagacctcctggggaagaccctcctgcagcagtcgctgcccccggaatcccag
caagtgcggtgggagaagcagcagccaaccccccggctcacactccgggacctgcagaat
aagagcagcagctgcagctcccccagctccagcgccaccagccttctccacaccgtgtcc
ccagagccccccaggcctccgcagcagcccgtaccaaccgagctctcactggccagcatc
actgtgcccctggagtccatcaaacccagcaacatcctgcccgtgactgtgtatgaccag
cacggcttccgcatcctcttccattttgcccgggacccactgccagggcgctccgacgtg
ctggtggtggtggtttccatgctgagcaccgccccccagcccatccgcaacatcgtgttc
cagtcagctgtccccaaggttatgaaggtgaagctgcagccaccctcgggcacggagctg
ccagcttttaaccccatcgtccacccctcagcaatcacccaggtcctgctgcttgccaac
ccccagaaggagaaggttcgcctccgctacaagctcaccttcaccatgggtgaccagacc
tacaacgagatgggggatgtggaccagttccccccacctgaaacctggggtagcctctag

DBGET integrated database retrieval system