KEGG   Homo sapiens (human): 26093
Entry
26093             CDS       T01001                                 
Symbol
CCDC9
Name
(RefSeq) coiled-coil domain containing 9
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4594
Other DBs
NCBI-GeneID: 26093
NCBI-ProteinID: NP_056418
HGNC: 24560
Ensembl: ENSG00000105321
Pharos: Q9Y3X0(Tdark)
UniProt: Q9Y3X0 B4DXW2
Position
19:47256525..47275723
AA seq 531 aa
MAATLDLKSKEEKDAELDKRIEALRRKNEALIRRYQEIEEDRKKAELEGVAVTAPRKGRS
VEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWEGSPGEQP
RGGGAGGRGRRGRGRGSPHLSGAGDTSISDRKSKEWEERRRQNIEKMNEEMEKIAEYERN
QREGVLEPNPVRNFLDDPRRRSGPLEESERDRREESRRHGRNWGGPDFERVRCGLEHERQ
GRRAGLGSAGDMTLSMTGRERSEYLRWKQEREKIDQERLQRHRKPTGQWRREWDAEKTDG
MFKDGPVPAHEPSHRYDDQAWARPPKPPTFGEFLSQHKAEASSRRRRKSSRPQAKAAPRA
YSDHDDRWETKEGAASPAPETPQPTSPETSPKETPMQPPEIPAPAHRPPEDEGEENEGEE
DEEWEDISEDEEEEEIEVEEGDEEEPAQDHQAPEAAPTGIPCSEQAHGVPFSPEEPLLEP
QAPGTPSSPFSPPSGHQPVSDWGEEVELNSPRTTHLAGALSPGEAWPFESV
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcagccacactcgatttgaaatcaaaggaggagaaggatgctgagttggacaagagg
atcgaggctcttcggcggaagaatgaggccctcatccggcgctaccaggagattgaggaa
gaccgtaagaaagctgaacttgagggagtcgcagtcacagctccccgaaagggccgctca
gtggagaaggagaacgtggcagtggagtcggagaagaacctgggtccttcccggaggtct
cctgggacccctcggcccccaggggccagcaaggggggccggactcctccacagcaggga
ggccgggccggcatgggccgagcatcgcgcagctgggagggcagccccggggagcagcct
cgaggaggaggagctgggggccgtggccggaggggccggggccgaggttcacctcacctc
tctggagctggagacacctcaatctctgaccgtaaatccaaggagtgggaggagcggcgc
aggcagaacattgagaagatgaatgaggagatggagaagatcgccgagtatgagcgcaac
cagcgggaaggggttcttgaacccaacccagtgcggaacttcctggacgacccccggcga
cgcagcgggcccctggaggagtctgagcgggaccgccgggaggagagccgccggcacggc
cgcaactgggggggccccgacttcgagcgggtgcgctgtggccttgagcacgagcggcag
ggccgccgagctggcctgggcagtgctggagacatgacgttgtccatgacgggccgggag
cggtcggagtacctgcgctggaagcaggagagggagaagatcgaccaggagcggctgcag
aggcaccgcaagcccactggccagtggaggcgcgagtgggatgccgagaagaccgatggg
atgttcaaggatggcccagtccctgcccatgaaccatcccaccgctatgatgaccaggcc
tgggcccggcccccgaagccccctacttttggggagttcctgtcccagcacaaagctgag
gccagcagccgcagaaggagaaagagcagtcggccccaggccaaggcagcgcccagggcc
tacagtgaccatgatgaccgctgggagacaaaagaaggggcagcatccccagcccctgag
actccacagcctacttcccccgagacttcccccaaggagacacccatgcagccacccgag
atcccagctcctgcccaccggcctcctgaagacgagggggaagagaatgagggggaagag
gatgaagaatgggaggacataagtgaggatgaggaagaggaggagatcgaggtggaagaa
ggtgatgaggaggaaccagcccaagaccaccaagccccagaggctgcccccaccgggatc
ccctgcagtgagcaggcccacggagtccccttcagtccggaggagcccctgctggagccc
caggcccctggcacgccttccagccctttctcaccacccagcggccaccagcctgtgtcc
gattggggtgaagaggtggagctgaattctccccggaccactcacctggctggcgccctc
tccccgggtgaggcctggccttttgagagtgtatga

DBGET integrated database retrieval system