KEGG   Homo sapiens (human): 26094Help
Entry
26094             CDS       T01001                                 

Gene name
DCAF4, WDR21, WDR21A
Definition
(RefSeq) DDB1 and CUL4 associated factor 4
  KO
K11799  DDB1- and CUL4-associated factor 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26094 (DCAF4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     26094 (DCAF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 26094
NCBI-ProteinID: NP_056419
OMIM: 616372
HGNC: 20229
Ensembl: ENSG00000119599
Vega: OTTHUMG00000160542
Pharos: Q8WV16(Tdark)
UniProt: Q8WV16 B2RDD6
Position
14q24.2
AA seq 495 aa AA seqDB search
MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGT
SSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIAR
MGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILAD
TNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDS
HILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCF
STGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGK
GWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPL
HVHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPG
LLMAVGQDLYCYSYS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagtcgctggcagagtagaagacgacatgggagaagaagccaccagcagaac
ccttggttcagactccgtgattctgaagacaggtctgactcccgggcagcacagcccgct
cacgattccggccacggtgatgacgagtctccgtcaacctcgtctggcacagctgggacc
tcctctgtgccagagctacctgggttttactttgaccctgaaaagaaacgctacttccgc
ttgctccctggacataacaactgcaaccccctgacgaaagagagcatccggcagaaggag
atggagagcaagagactgcggctgctccaggaagaagacagacggaaaaagattgccagg
atgggatttaatgcatcttccatgctacgaaaaagccagctgggttttctcaacgtcacc
aattactgccatttagcccacgagctgcgtctcagctgcatggagaggaaaaaggtccag
attcgaagcatggatccctccgccttggcaagcgaccgatttaacctcatactggcagat
accaacagtgaccggctcttcacagtgaacgatgttaaagttggaggctccaagtatggt
atcatcaacctgcaaagtctgaagacccctacgctcaaggtgttcatgcacgaaaacctc
tacttcaccaaccggaaggtgaattcggtgtgctgggcctcgctgaatcacttggattcc
cacattctgctatgcctcatgggactcgcagagactccaggctgtgccaccctgctccca
gcatcactgttcgtcaatagtcacccaggaatagaccggcctggcatgctctgcagtttc
cggatccctggtgcctggtcctgtgcctggtccctgaatatccaagcaaataactgcttc
agtacaggcttgtctcggcgggtcctgttgaccaacgtggtgacgggacaccggcagtcc
tttgggaccaacagtgatgtcttggcccagcagtttgctctcatggctcctctgctgttt
aatggctgccgctctggggaaatctttgccattgatctgcgttgtggaaatcaaggcaag
ggatggaaggccacccgcctgtttcatgattcagcagtgacctctgtgcggatcctccaa
gatgagcaatacctgatggcttcagacatggctggaaagatcaagctgtgggacctgagg
accacgaagtgcgtaaggcagtacgaaggccacgtgaatgagtacgcctacctgcccctg
catgtgcacgaggaagaaggaatcctggtggcagtgggccaggactgctacacgagaatc
tggagcctccacgatgcccgcctactgagaaccataccctccccgtaccctgcctccaag
gccgacattcccagtgtggccttctcgtcgcggctggggggctcccggggcgcgccgggg
ctgctcatggctgtcgggcaggacctttactgttactcctacagctaa

DBGET integrated database retrieval system