KEGG   Homo sapiens (human): 26100Help
Entry
26100             CDS       T01001                                 

Gene name
WIPI2, ATG18B, Atg21, CGI-50, IDDSSA, WIPI-2
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 2
  KO
K17908  autophagy-related protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05017  Spinocerebellar ataxia
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26100 (WIPI2)
   04136 Autophagy - other
    26100 (WIPI2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    26100 (WIPI2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    26100 (WIPI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26100 (WIPI2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    26100 (WIPI2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    26100 (WIPI2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    26100 (WIPI2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    26100 (WIPI2)
Transporters [BR:hsa02000]
 Other transporters
  Others
   26100 (WIPI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 VID27
Motif
Other DBs
NCBI-GeneID: 26100
NCBI-ProteinID: NP_056425
OMIM: 609225
HGNC: 32225
Ensembl: ENSG00000157954
Vega: OTTHUMG00000121179
Pharos: Q9Y4P8(Tbio)
UniProt: Q9Y4P8 A0A024R823
Position
7p22.1
AA seq 454 aa AA seqDB search
MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSS
VDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTIL
AVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSAT
IGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFE
FRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLM
ASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMYNLD
PQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYT
DDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggcgagccagagcggggaggccggcgccggccagctgctcttcgccaacttc
aaccaggacaacacagaagtgaaaggggcatcaagagcagctggtcttggccgtcgcgct
gttgtctggtccctagctgttggtagtaagtccggttataaatttttctccctttcttct
gtggataagctggaacagatctatgaatgcaccgatacggaagatgtgtgcattgtagag
agattgttctccagcagcctagtggccatcgtcagccttaaagcaccaaggaagctaaag
gtttgccactttaagaagggaactgagatctgcaactacagctactccaacacgattctg
gctgtgaagctcaacaggcagaggctgatagtatgcctggaggagtccctgtacatccac
aacattcgggacatgaaggtgctgcatacgatcagggagacgcctccaaaccctgcaggc
ctgtgtgcgctgtcaatcaacaacgacaactgctacttggcgtacccagggagcgcgacc
atcggagaggtgcaggtcttcgataccattaatttgagagctgcaaacatgattccggct
cacgacagtcctttagcggcactggcctttgacgcaagtggaactaaacttgccacggct
tcggagaaggggaccgtgattagggtattttccattccagaaggacaaaaactctttgag
tttcggagaggagtaaagaggtgcgtgagcatctgctccctggccttcagcatggacggc
atgttcctctccgcctccagcaacactgagaccgtgcacatcttcaaactcgagactgtg
aaagaaaaacccccagaggagcccaccacctggaccgggtacttcgggaaagtgctcatg
gcctccaccagctacctgccttcccaagtgacagaaatgttcaaccagggcagagccttc
gccacggtccgcctgccattctgcggccacaaaaacatctgctcgctagccacaattcag
aagatcccgcggttgttggtgggtgccgccgacgggtacctgtacatgtacaacctggac
ccccaggagggcggcgagtgtgccctgatgaagcagcaccggctggacggcagtctggaa
acgaccaatgagatcttggactctgcctctcacgactgccccttagtcactcagacatac
ggcgcagctgcaggaaaaggtacttacgtgccttcatccccaacgagacttgcctacaca
gacgacctgggtgctgtgggtggcgcctgcctggaggacgaggccagcgccctgcgcctg
gatgaggacagcgagcacccgcccatgattcttcggactgactga

KEGG   Homo sapiens (human): 55062Help
Entry
55062             CDS       T01001                                 

Gene name
WIPI1, ATG18, ATG18A, WIPI49
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 1
  KO
K17908  autophagy-related protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05017  Spinocerebellar ataxia
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55062 (WIPI1)
   04136 Autophagy - other
    55062 (WIPI1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    55062 (WIPI1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55062 (WIPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55062 (WIPI1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55062 (WIPI1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55062 (WIPI1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    55062 (WIPI1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55062 (WIPI1)
Transporters [BR:hsa02000]
 Other transporters
  Others
   55062 (WIPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 BCAS3
Motif
Other DBs
NCBI-GeneID: 55062
NCBI-ProteinID: NP_060453
OMIM: 609224
HGNC: 25471
Ensembl: ENSG00000070540
Vega: OTTHUMG00000179873
Pharos: Q5MNZ9(Tbio)
UniProt: Q5MNZ9
Position
17q24.2
AA seq 446 aa AA seqDB search
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgaggccgcggacgctcccccgggcggggttgagtcggcgctcagctgcttc
tctttcaaccaggactgcacatccctagcaactggaactaaagccgggtataagctgttt
tctctgagttctgtggagcagctggatcaagtccacggaagcaatgaaatcccggacgtc
tacatcgtggagcgcctcttctccagcagcctggtggtggtagtcagtcacacaaaacca
cggcagatgaacgtgtatcacttcaagaaaggcacagagatctgtaattacagctactcc
agcaacatcttgtccataaggctgaaccggcaaaggctgctggtttgcctagaagagtcc
atttatattcacaacattaaagacatgaagctgttgaagaccctcctggatattcctgca
aacccaacaggtctatgtgctctctctatcaaccattccaattcttacctggcctatcct
ggaagcctgacttcaggggagattgtgctttatgatggaaactccctgaaaacagtctgc
actattgctgcccatgagggaacactagctgccatcaccttcaatgcctcaggctccaaa
ctagcaagtgcgtctgaaaaaggcacagtcatccgggtgttctctgtccctgatgggcaa
aagctctatgagttccggagagggatgaaaaggtatgtgacaatcagctctctagtgttc
agtatggattcacaattcctctgcgcctccagtaacaccgagacggtacacatcttcaag
ctggaacaggtcaccaacagtcgaccagaagagccttcgacctggagtggctacatggga
aagatgtttatggctgctaccaactacctccctacccaggtgtcagacatgatgcatcag
gacagggcttttgccactgcacgcttgaacttctccggacagaggaacatctgtaccctc
tcaacgatccagaagttgccacggctgctagttgcgtcatccagtggacacctttatatg
tacaatttggatcctcaggatggaggagagtgtgtcttaatcaaaacccacagcttgctt
ggctcaggaacaacagaagagaataaagaaaatgacctcagaccttccttacctcagtct
tatgcagcgaccgtagccagaccaagtgcatcttcagcctccacggtgccaggttattct
gaggacggcggggcgctgcgaggagaagttattcctgaacatgagtttgcgacgggacca
gtgtgtcttgatgatgagaatgagtttcctcctataatcttgtgccgtggaaatcagaag
ggcaaaacgaagcagtcatga

DBGET integrated database retrieval system