KEGG   Homo sapiens (human): 26112
Entry
26112             CDS       T01001                                 
Symbol
CCDC69
Name
(RefSeq) coiled-coil domain containing 69
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Lambda_tail_I Dehydratase_MU
Other DBs
NCBI-GeneID: 26112
NCBI-ProteinID: NP_056436
OMIM: 619288
HGNC: 24487
Ensembl: ENSG00000198624
Pharos: A6NI79(Tdark)
UniProt: A6NI79 Q7L2X4
Position
5:complement(151181052..151224092)
AA seq 296 aa
MGCRHSRLSSCKPPKKKRQEPEPEQPPRPEPHELGPLNGDTAITVQLCASEEAERHQKDI
TRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRASYEQEKEALT
HSFREASSTQQETIDRLTSQLEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELES
LHFVIEMKNERIHELDRRLILMETVKEKNLILEEKITTLQQENEDLHVRSRNQVVLSRQL
SEDLLLTREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT
NT seq 891 nt   +upstreamnt  +downstreamnt
atgggctgcagacacagcaggctgagcagctgcaaacccccgaaaaagaagcgccaagaa
ccagaaccagaacagccacccagaccagagccccatgaattaggtcccctcaatggggac
acagctataactgtccagctctgtgcatcagaggaggctgagcggcaccagaaggatata
accagaattctccagcaacatgaggaggaaaagaagaaatgggcacaacaggtggagaag
gaaagggagctagagcttcgagacagactggatgagcagcaaagggtcctggaaggaaag
aatgaagaggccctgcaagtcctccgggcctcatatgaacaggagaaagaagcgcttacc
cactctttccgggaggccagttctacccagcaggagaccatagacagactgacctcacag
ctggaggctttccaggccaaaatgaagagggtggaggagtccattctgagccgaaactat
aagaaacatatccaggattatgggagccccagccagttctgggagcaggagctggagagc
ttacactttgtcatcgagatgaagaatgagcgtattcatgagctggacaggcggctgatc
ctcatggaaacagtgaaagagaaaaatctgatattggaggaaaaaattacgaccctgcaa
caggaaaatgaggacctccatgtccgaagccgcaaccaggtggtcctgtcaaggcagctg
tcagaagacctgcttctcacgcgtgaggccctggagaaggaggtgcagctgcggcgacag
ctccagcaggagaaggaggagctgttgtaccgggtccttggggccaatgcctcgcctgcc
ttccctctggcccctgtcactcccactgaggtctctttcctcgccacatag

DBGET integrated database retrieval system