KEGG   Homo sapiens (human): 26123Help
Entry
26123             CDS       T01001                                 

Gene name
TCTN3, C10orf61, JBTS18, OFD4, TECT3
Definition
(RefSeq) tectonic family member 3
  KO
K19382  tectonic-1/3
Organism
hsa  Homo sapiens (human)
Disease
H00454  Oral-facial-digital syndrome
H00530  Joubert syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26123 (TCTN3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   TCTN-B9D complex
    26123 (TCTN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1619 TrmO_C
Motif
Other DBs
NCBI-GeneID: 26123
NCBI-ProteinID: NP_056446
OMIM: 613847
HGNC: 24519
Ensembl: ENSG00000119977
Vega: OTTHUMG00000018814
Pharos: Q6NUS6(Tdark)
UniProt: Q6NUS6
Position
10q24.1
AA seq 607 aa AA seqDB search
MRTPQLALLQVFFLVFPDGVRPQPSSSPSGAVPTSLELQRGTDGGTLQSPSEATATRPAV
PGLPTVVPTLVTPSAPGNRTVDLFPVLPICVCDLTPGACDINCCCDRDCYLLHPRTVFSF
CLPGSVRSSSWVCVDNSVIFRSNSPFPSRVFMDSNGIRQFCVHVNNSNLNYFQKLQKVNA
TNFQALAAEFGGESFTSTFQTQSPPSFYRAGDPILTYFPKWSVISLLRQPAGVGAGGLCA
ESNPAGFLESKSTTCTRFFKNLASSCTLDSALNAASYYNFTVLKVPRSMTDPQNMEFQVP
VILTSQANAPLLAGNTCQNVVSQVTYEIETNGTFGIQKVSVSLGQTNLTVEPGASLQQHF
ILRFRAFQQSTAASLTSPRSGNPGYIVGKPLLALTDDISYSMTLLQSQGNGSCSVKRHEV
QFGVNAISGCKLRLKKADCSHLQQEIYQTLHGRPRPEYVAIFGNADPAQKGGWTRILNRH
CSISAINCTSCCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSL
TTLVNFVDITQKPQPPRGQPKMDWKWPFDFFPFKVAFSRGVFSQKCSVSPILILCLLLLG
VLNLETM
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccccacagctcgcgctcctgcaagtgttctttctggtgttccccgatggcgtc
cggcctcagccctcttcctccccatcaggggcagtgcccacgtctttggagctgcagcga
gggacggatggcggaaccctccagtccccttcagaggcgactgcaactcgcccggccgtg
cctggactccctacagtggtccctactctcgtgactccctcggcccctgggaataggact
gtggacctcttcccagtcttaccgatctgtgtctgtgacttgactcctggagcctgcgat
ataaattgctgctgcgacagggactgctatcttctccatccgaggacagttttctccttc
tgccttccaggcagcgtaaggtcttcaagctgggtttgtgtagacaactctgttatcttc
aggagtaattccccgtttccttcaagagttttcatggattctaatggaatcaggcagttt
tgtgtccatgtgaacaactcaaacttaaactatttccagaagcttcaaaaggtcaatgca
accaacttccaggccctggctgcagagtttggaggcgaatcattcacttcaacattccaa
actcaatcaccaccatctttttacagggctggggaccccattcttacttacttccccaag
tggtctgtaataagcttgctgagacaacctgcaggagttggagctgggggactctgtgct
gaaagcaatcctgcaggtttcctagagagtaaaagtacaacttgcactcgttttttcaag
aacctggctagtagctgtaccttggattcagccctcaatgctgcctcttactataacttc
acagtcttaaaggttccaagaagcatgactgatccacagaatatggagttccaggttcct
gtaatacttacctcacaggctaatgctcctctgttggctggaaacacttgtcagaatgta
gtttctcaggtcacctatgagatagagaccaatgggacttttggaatccagaaagtttct
gtcagtttgggacaaaccaacctgactgttgagccaggcgcttccttacagcaacacttc
atccttcgcttcagggcttttcaacagagcacagctgcttctctcaccagtcctagaagt
gggaatcctggctatatagttgggaagccactcttggctctgactgatgatataagttac
tcaatgaccctcttacagagccagggtaatggaagttgctctgttaaaagacatgaagtg
cagtttggagtgaatgcaatatctggatgcaagctcaggttgaagaaggcagactgcagc
cacttgcagcaggagatttatcagactcttcatggaaggcccagaccagagtatgttgcc
atctttggtaatgctgacccagcccagaaaggagggtggaccaggatcctcaacaggcac
tgcagcatttcagctataaactgtacttcctgctgtctcataccagtttccctggagatc
caggtattgtgggcatatgtaggtctcctgtccaacccgcaagctcatgtatcaggagtt
cgattcctataccagtgccagtctatacaggattctcagcaagttacagaagtatctttg
acaactcttgtgaactttgtggacattacccagaagccacagcctccaaggggccaaccc
aaaatggactggaaatggccattcgacttctttcccttcaaagtggcattcagcagagga
gtattctctcaaaaatgctcagtctctcccatccttatcctgtgcctcttactacttgga
gttctcaacctagagactatgtga

DBGET integrated database retrieval system