KEGG   Homo sapiens (human): 26136Help
Entry
26136             CDS       T01001                                 

Gene name
TES, TESS, TESS-2
Definition
(RefSeq) testin LIM domain protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PET LIM Ig_Tie2_1
Motif
Other DBs
NCBI-GeneID: 26136
NCBI-ProteinID: NP_056456
OMIM: 606085
HGNC: 14620
Ensembl: ENSG00000135269
Vega: OTTHUMG00000023092
Pharos: Q9UGI8(Tbio)
UniProt: Q9UGI8 A4D0U5
Structure
PDB: 

Position
7q31.2
AA seq 421 aa AA seqDB search
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEED
RKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQ
ALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVK
KYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCK
LSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPR
CAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVV
CQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacctggaaaacaaagtgaagaagatgggcttaggtcacgagcaaggatttggagcc
ccttgtttaaaatgcaaagaaaaatgtgaaggattcgaactgcacttctggagaaaaata
tgtcgtaactgcaagtgtggccaagaagagcatgatgtcctcttgagcaatgaagaggat
cgaaaagtgggaaaactttttgaagacaccaagtataccactctgattgcaaaactaaag
tcagatggaattcccatgtataaacgcaatgttatgatattgacgaatccagttgctgcc
aagaagaatgtctccatcaatacagttacctatgagtgggctcctcctgtccagaatcaa
gcattggccaggcagtacatgcagatgctacccaaggaaaagcagccagtagcaggctca
gagggggcacagtaccggaagaagcagctggcaaagcagctccctgcacatgaccaggac
ccttcaaagtgccatgagttgtctcccagagaggtgaaggagatggagcagtttgtgaag
aaatataagagcgaagctctgggagtaggagatgtcaaacttccctgtgagatggatgcc
caaggccccaaacaaatgaacattcctggaggggatagaagcaccccagcagcagtgggg
gccatggaggacaaatctgctgagcacaaaagaactcaatattcctgctattgctgcaaa
ctgagtatgaaagaaggtgacccagccatctatgccgaaagggctggctatgataaactg
tggcacccagcttgttttgtctgcagcacctgccatgaactcctggttgacatgatttat
ttttggaagaatgagaagctatactgtggcagacattactgtgacagcgagaaaccccga
tgtgctggctgtgacgagctgatattcagcaatgagtatacccaggcagaaaaccagaat
tggcacctgaaacacttctgctgctttgactgtgatagcattctagctggggagatatac
gtgatggtcaatgacaagcccgtgtgcaagccctgctatgtgaagaatcacgctgtggtg
tgtcaaggatgccacaatgccatcgacccagaagtgcagcgggtgacctataacaatttc
agctggcatgcatccacagagtgctttctgtgctcttgctgcagcaaatgcctcattggg
cagaagttcatgccagtagaagggatggttttctgttcagtggaatgtaagaagaggatg
tcttag

DBGET integrated database retrieval system