KEGG   Homo sapiens (human): 26146
Entry
26146             CDS       T01001                                 
Symbol
TRAF3IP1, CFAP116, FAP116, IFT54, MIP-T3, MIPT3, SLSN9
Name
(RefSeq) TRAF3 interacting protein 1
  KO
K19680  TRAF3-interacting protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00538  Senior-Loken syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    26146 (TRAF3IP1)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex B2
   26146 (TRAF3IP1)
SSDB
Motif
Pfam: MIP-T3_C MIP-T3 MG4
Other DBs
NCBI-GeneID: 26146
NCBI-ProteinID: NP_056465
OMIM: 607380
HGNC: 17861
Ensembl: ENSG00000204104
UniProt: Q8TDR0
Structure
Position
2:238320518..238400900
AA seq 691 aa
MNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKS
DNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLNKLS
SDDAVRRVLAGEKGEVKGRASLTSRSQELDNKNVREEESRVHKNTEDRGDAEIKERSTSR
DRKQKEELKEDRKPREKDKDKEKAKENGGNRHREGERERAKARARPDNERQKDRGNRERD
RDSERKKETERKSEGGKEKERLRDRDRERDRDKGKDRDRRRVKNGEHSWDLDREKNREHD
KPEKKSASSGEMSKKLSDGTFKDSKAETETEISTRASKSLTTKTSKRRSKNSVEGRKEDN
ISAKSLDSIVSGINNEPNQETTTSEIGTKEANINSTSISDDNSASLRCENIQPNPTEKQK
GDSTSDAEGDAGPAGQDKSEVPETPEIPNELSSNIRRIPRPGSARPAPPRVKRQDSMEAL
QMDRSGSGKTVSNVITESHNSDNEEDDQFVVEAAPQLSEMSEIEMVTAVELEEEEKHGGL
VKKILETKKDYEKLQQSPKPGEKERSLFESAWKKEKDIVSKEIEKLRTSIQTLCKSALPL
GKIMDYIQEDVDAMQNELQMWHSENRQHAEALQQEQRITDCAVEPLKAELAELEQLIKDQ
QDKICAVKANILKNEEKIQKMVYSINLTSRR
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgaacgcggcggtggtgaggcggacgcaggaggcgctggggaaagtgattcggaggccg
ccgctgaccgagaagctgctgagcaagcccccgttccgctacctgcacgacatcatcacg
gaggtgattagaatgactggtttcatgaagggcctctacacagacgccgagatgaagtct
gataatgtgaaggataaagatgcaaaaattagcttcctacaaaaggccatagacgtggtt
gtaatggtgtcgggagagccactgttggccaaaccagcccgaatcgtggcggggcatgag
cctgaaagaacaaacgagctgctccagataattggaaaatgctgtctcaacaagctctct
agtgacgatgcggtgcggagggttttagctggagagaagggagaagtgaaaggccgggcc
tcactgacctcaagatctcaggaattggataataagaatgtgcgagaagaagagtccaga
gttcacaaaaatacagaggatagaggagacgctgaaataaaagagagaagtacaagcaga
gatcgaaaacagaaggaagaattgaaagaagaccgcaagccaagagaaaaggacaaggac
aaggagaaggccaaggagaatggcggaaacagacacagagaaggggagagagagagagcc
aaagcccgggccaggccagacaacgagcgacagaaagacagaggcaacagggagcgggac
agagactccgagcgcaagaaggagacagagagaaagagtgagggggggaaagagaaggag
agactgagagacagggaccgagagcgcgaccgggacaaagggaaggacagggacagacgg
agagtgaaaaacggggagcactcctgggacctggacagggagaagaacagagagcatgac
aaacctgagaaaaagtcagcaagctcaggggagatgtctaaaaagttatcagatggaact
tttaaagactccaaggctgaaacagagactgagatttccactagagcttccaagtcattg
acaacaaaaacatcaaaacggcgatccaaaaattcagtggaaggaaggaaggaggataat
atttcagctaaaagtttagactccatagtgtctggaataaataatgagccaaatcaggaa
acgacaacatcagaaataggaacaaaagaagctaatattaactcaactagtatttcagat
gataattcagctagtctgcggtgtgagaatattcagcccaaccccacagagaagcagaaa
ggtgactccaccagtgatgcagaaggagatgctggacctgctggccaagataagtctgag
gtgccagagactccagaaattcctaatgagctttcatccaacatcagaagaattcctcgg
cctgggagtgcaagaccagcccctccccgggtcaaacggcaagacagcatggaggcgcta
caaatggataggtcagggagtggtaaaaccgtttcaaatgtgattacagagtcacacaat
tctgacaatgaagaggatgatcaatttgtggtggaagctgcccctcagctctctgaaatg
tcagaaattgaaatggtaacagcagtggaactagaagaagaggagaagcatggtggactt
gtgaaaaaaattttggagacgaagaaagattatgagaaattgcagcagtcacccaaacct
ggggagaaggagcgatctctctttgagtcggcatggaagaaggagaaggacatcgtttcc
aaggagatagagaagctccgcacgtccatccagaccctgtgcaagagcgcacttcccctg
gggaagatcatggactacatccaggaagacgtggatgccatgcagaatgagctgcagatg
tggcacagcgagaacaggcagcacgccgaggccctgcagcaggagcagaggatcacagac
tgtgccgtggagcccttaaaggctgagctcgcggagctggagcagctgatcaaagaccag
caagacaagatctgtgctgtgaaggccaacatcctcaagaatgaagaaaaaatccagaaa
atggtatatagtatcaatttgacttcgagaaggtga

DBGET integrated database retrieval system