KEGG   Homo sapiens (human): 26156
Entry
26156             CDS       T01001                                 

Gene name
RSL1D1, CSIG, L12, PBK1, UTP30
Definition
(RefSeq) ribosomal L1 domain containing 1
  KO
K14775  ribosome biogenesis protein UTP30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    26156 (RSL1D1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    26156 (RSL1D1)
SSDB
Motif
Pfam: Ribosomal_L1 SUIM_assoc
Other DBs
NCBI-GeneID: 26156
NCBI-ProteinID: NP_056474
OMIM: 615874
HGNC: 24534
Ensembl: ENSG00000171490
Vega: OTTHUMG00000129824
Pharos: O76021(Tbio)
UniProt: O76021
Position
16p13.13
AA seq 490 aa
MEDSASASLSSAAATGTSTSTPAAPTARKQLDKEQVRKAVDALLTHCKSRKNNYGLLLNE
NESLFLMVVLWKIPSKELRVRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNK
HGIKTVSQIISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVP
VSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENIVAVTKGLSEK
LPEKWESVKLLFVKTEKSAALPIFSSFVSNWDEATKRSLLNKKKKEARRKRRERNFEKQK
ERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNE
SEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAE
SETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKW
PKKPKVPQST
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaggattcggcctcggcctcgctgtcttctgcagccgctactggaacctccacctcg
actccagcggccccgacagcacggaagcagctggataaagaacaggttagaaaggcagtg
gacgctctcttgacgcattgcaagtccaggaaaaacaattatgggttgcttttgaatgag
aatgaaagtttatttttaatggtggtattatggaaaattccaagtaaagaactgagggtc
agattgaccttgcctcatagtattcgatcagattcagaagatatctgtttatttacgaag
gatgaacccaattcaactcctgaaaagacagaacagttttatagaaagcttttaaacaag
catggaattaaaaccgtttctcagattatctccctccaaactctaaagaaggaatataaa
tcctatgaagccaagctccgccttctgagcagttttgatttcttccttactgatgccaga
attaggcggctcttaccctcactcattgggagacatttctatcaaagaaagaaagttcca
gtatctgtaaaccttctgtccaagaatttatcaagagagatcaatgactgtataggtgga
acagtcttaaacatttctaaaagtggttcttgcagtgctatacgtattggtcacgttgga
atgcaaattgagcacatcattgaaaacattgttgctgtcaccaaaggactttcagaaaaa
ttgccagagaagtgggagagcgtgaaactcctgtttgtgaaaactgagaaatcggctgca
cttcccatcttttcctcgtttgtcagcaattgggatgaagccaccaaaagatctttgctt
aataagaagaaaaaagaggcaaggagaaaacgaagagaaagaaattttgaaaaacaaaag
gagaggaagaagaagaggcagcaggctaggaagactgcatcagttcttagtaaagatgat
gtggcacctgaaagtggtgatactacagtgaagaaacctgaatcaaagaaggaacagacc
ccagagcatgggaagaaaaaacgtggcagaggaaaagcccaagttaaagcaacaaatgaa
tccgaagacgaaatcccacagctggtaccaataggaaagaagactccagctaatgaaaaa
gtagagattcaaaaacatgccacaggaaagaagtctccagcaaagagtcctaatcccagc
acacctcgtgggaagaaaagaaaggctttgccagcatctgagaccccaaaagctgcagag
tctgagaccccagggaaaagcccagagaagaagccaaaaatcaaagaagaggcagtgaag
gaaaaaagtccttcgctggggaaaaaagatgcgagacagactccaaaaaagccagaggcc
aagtttttcaccactcctagtaaatctgtgagaaaagcttcccacacccccaaaaaatgg
cccaaaaaacccaaagtaccccagtcgacctaa

DBGET integrated database retrieval system