KEGG   Homo sapiens (human): 261726
Entry
261726            CDS       T01001                                 
Symbol
TIPRL, TIP, TIP41, TIPRL1
Name
(RefSeq) TOR signaling pathway regulator
  KO
K17607  type 2A phosphatase activator TIP41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    261726 (TIPRL)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     261726 (TIPRL)
SSDB
Motif
Pfam: TIP41
Other DBs
NCBI-GeneID: 261726
NCBI-ProteinID: NP_690866
OMIM: 611807
HGNC: 30231
Ensembl: ENSG00000143155
UniProt: O75663
Position
1:168178962..168202109
AA seq 272 aa
MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHG
SGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTL
LGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFF
LLLRFFLRIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQ
YLPIKEAVCEKLIFPERIDPNPADSQKSTQVE
NT seq 819 nt   +upstreamnt  +downstreamnt
atgatgatccacggcttccagagcagccaccgggatttctgcttcgggccctggaagctg
acggcgtccaagacccacatcatgaagtcggcggatgtggagaaattagccgatgaatta
catatgccatctctccctgaaatgatgtttggagacaacgttttaagaatccagcatggg
tctggctttggaattgagttcaatgctacagatgcgttaagatgtgtaaacaactaccaa
ggaatgcttaaagtggcctgtgctgaagagtggcaagaaagcaggacggagggtgaacac
tccaaagaggttattaaaccatatgattggacctatacaacagattataagggaacctta
cttggagaatctcttaagttaaaggttgtacctacaacagatcatatagatacagaaaaa
ttgaaagccagagaacagattaagttttttgaagaagttctcctttttgaggatgaactt
catgatcatggagtttcaagcctgagtgtgaagattagagtaatgccttctagctttttc
ctgctgttgcggtttttcttgagaattgatggggtgcttatcagaatgaatgacacgaga
ctttaccatgaggctgacaagacctacatgttacgagaatatacgtcacgagaaagcaaa
atttctagtttgatgcatgttccaccttccctcttcacggaacctaatgaaatatcccag
tatttaccaataaaggaagcagtttgtgagaagctaatatttccagaaagaattgatcct
aacccagcagactcacaaaaaagtacacaagtggaataa

DBGET integrated database retrieval system