KEGG   Homo sapiens (human): 26188Help
Entry
26188             CDS       T01001                                 

Gene name
OR1C1, HSTPCR27, OR1-42, OR1.5.10, ORL211, TPCR27
Definition
(RefSeq) olfactory receptor family 1 subfamily C member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26188 (OR1C1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26188 (OR1C1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26188 (OR1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26188
NCBI-ProteinID: NP_036485
HGNC: 8182
Ensembl: ENSG00000221888
Vega: OTTHUMG00000040198
Pharos: Q15619(Tdark)
UniProt: Q15619 A0A126GV94
Position
1q44
AA seq 314 aa AA seqDB search
MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMY
FFLSNLAFVDICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAY
DRYVAICHPLHYTARMNLCLCVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCD
LNPLLQLSCSDVSFNVMIIFAVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVST
CSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSMVAPMLNPFIYTLRNRDMKRG
LQKMLLKCTVFQQQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagaaatctaacagttgtcagggaattcgtccttctgggacttcctagctca
gcagagcagcagcacctcctgtctgtgctctttctctgtatgtatttagccaccaccttg
gggaacatgctcatcattgcgacgattggctttgactctcacctccattcccctatgtac
ttcttccttagtaacttggcctttgttgacatctgctttacgtcgactacagtcccccaa
atggtagtgaatatcttgactggcaccaagactatctcttttgcaggctgcctcacccag
ctcttcttcttcgtttcttttgtgaatatggacagcctccttctgtgtgtgatggcgtat
gatagatatgtggcgatttgccaccccttacattacaccgccagaatgaacctgtgcctt
tgtgtccagctagtggctggactgtggcttgttacttacctccacgccctcctgcatact
gtcctaatagcacagctgtccttctgtgcctccaatatcatccatcatttcttctgtgat
ctcaatcctctcctgcagctctcttgctctgacgtctccttcaatgtaatgatcattttt
gcagtaggaggtctattggctctcacgccccttgtctgtatcctcgtatcttatggactt
atcttctccactgttctgaagatcacctctactcagggcaagcagagagctgtttccacc
tgcagctgccacctgtcagtggtggtgttgttttacggcacagccatcgccgtctatttc
agcccttcatccccccatatgcctgagagcgacactctgtcaaccatcatgtattcaatg
gtggctccgatgctgaatcctttcatctataccctaaggaacagggatatgaagagggga
cttcagaaaatgcttctcaagtgcacagtctttcagcagcaataa

DBGET integrated database retrieval system