KEGG   Homo sapiens (human): 2620
Entry
2620              CDS       T01001                                 

Gene name
GAS2, GAS-2
Definition
(RefSeq) growth arrest specific 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GAS2 CH
Other DBs
NCBI-GeneID: 2620
NCBI-ProteinID: NP_001137302
OMIM: 602835
HGNC: 4167
Ensembl: ENSG00000148935
Vega: OTTHUMG00000166071
Pharos: O43903(Tbio)
UniProt: O43903
Position
11p14.3
AA seq 313 aa
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
VVSASYKAKKEIK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtgcactgctctgagcccaaaggtacgcagtggacctggcctctctgatatgcatcag
tatagccaatggctagccagcagacatgaagctaatttgctaccaatgaaagaagatctg
gccttgtggttaaccaatctattagggaaggagattacagcagaaacttttatggagaag
ttggacaatggtgccttgctctgtcaacttgcagaaactatgcaggagaaattcaaggag
agcatggatgctaacaagcccacaaagaatctaccgttgaagaagatcccatgcaaaacc
agtgcaccctcgggctccttttttgccagagacaatacagcaaatttcttatcctggtgc
cgagatttaggggtggatgaaacgtgtctatttgaatcggaaggtttggtcctccacaag
caacccagagaagtgtgtctctgtctgctagagcttggccggattgcagccaggtatggt
gtggagcctcctggtttgataaagctggaaaaagagattgaacaagaagaaacactttct
gccccttctccttcaccttctccttcatcaaagtcttctggaaaaaagagtacaggaaac
ttactggatgatgcagtgaaacgaatttctgaagatcctccttgcaaatgcccaaacaag
ttctgtgtggagcggctctcccaaggaagataccgagtgggagaaaagatcctcttcatt
aggatgctgcacaacaaacatgtcatggtccgtgtgggaggaggctgggaaacttttgca
gggtatttgttgaaacacgacccctgccgaatgctgcagatctcccgtgtggatggcaaa
acatcccctatccaaagcaaatctccaactctaaaggacatgaatccagataactacttg
gtggtctctgccagttataaggctaagaaggaaattaagtga

DBGET integrated database retrieval system