KEGG   Homo sapiens (human): 26205
Entry
26205             CDS       T01001                                 

Gene name
GMEB2, GMEB-2, P79PIF, PIF79
Definition
(RefSeq) glucocorticoid modulatory element binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SAND
Other DBs
NCBI-GeneID: 26205
NCBI-ProteinID: NP_036516
OMIM: 607451
HGNC: 4371
Ensembl: ENSG00000101216
Vega: OTTHUMG00000032988
Pharos: Q9UKD1(Tdark)
UniProt: Q9UKD1 B4DQS0
Position
20q13.33
AA seq 530 aa
MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAA
AAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGL
KDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPR
LARATSGPAAMASQVLTQSAQLALGPGVPVPQLTSVPLGKVVSTLPSTVLGKGSLQAPPA
SSPASPLLGGYTVLASSGSTYPSTVEIHPDASSLTVLSTAAVQDGSTVFKVVSPLQLLTL
PGLGPTLQNVAQASPGSSTIVTVPAGAAPGPEEHTATIEVAAMAEDHERK
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcgactcccgacgtgagtgtgcacatggaggaggtggtggttgtgacaactccggac
actgcagtggacggcagtggtgtggagggggtgaagaccgtgttggtgacgaccaacttg
gcccctcacgggggcgacctgacggaagataacatggagacagaaaatgcagcggcagca
gctgccgcggccttcacagcctcctcccagctcaaggaagccgtgttagtgaagatggct
gaagagggggagaacctggaagctgagattgtgtaccccatcacctgtggagacagcaga
gccaacctcatctggaggaagtttgtgtgtcccggcatcaatgtgaaatgtgttcagtac
gacgagcatgtaatcagcccaaaggaatttgtgcacctggccgggaagtccaccctgaag
gactggaagagagccatccgcatgaacggcatcatgctcaggaagatcatggactccggg
gaactggacttctaccagcatgacaaggtctgctccaacacctgccgcagcacaaagatt
gacctctcaggagcccgtgtgtccctgagcagccccacgtcggccgagtacattcccctc
acgcccgccgcagccgacgtgaatgggtctcctgcgaccatcaccatagagacctgtgaa
gaccctggcgactggaccgcggccattggagatgacacatttaccttctggcgggggctg
aaggacgccggcctgctggacgaggtcatccaggagttccaccaggagctggtggagacc
atgagaggcctgcagcagcgggtccaggaccctcccctgcagcttcgagatgctgtactt
ctcaacaacatcgtgcagaacttcggcatgctggacctggtgaagaaggtgctggccagc
cacaagtgccagatggaccgctcgcgggagcagtacgcccgggacctggcagccctggag
cagcagtgtgatgagcatcgtcgccgagccaaggagctgaagcacaagtcccagcacctc
agcaacgtgctcatgacgctgacgccggtctccctgccaccgcctgtgaagcggccccgg
cttgcacgtgccacatcaggaccggccgccatggcctcgcaggtgctcacccagtctgcc
cagctggcgcttggcccgggcgtgcccgtcccccagctgaccagcgtgccccttggtaaa
gtggtgtccaccctgccgtccaccgtcctgggcaagggttcccttcaggcgccccccgcc
agctccccggcctccccgctgctcgggggatacacagtcttggcctcttccggctccacc
taccccagcacagtggagatccacccggacgcgtccagcctcacggtcctgagcacggcc
gccgtgcaggacggtagcacggtgttcaaggtggtcagcccgctacagctgctcacgttg
cctggcctgggccccaccctgcagaacgtggcccaggcctcgcctggctccagcacaatt
gtgacagtgcccgcaggggctgcccccgggcctgaggagcacacggccaccattgaggtg
gctgccatggcagaggaccacgagcggaagtag

DBGET integrated database retrieval system