KEGG   Homo sapiens (human): 26212Help
Entry
26212             CDS       T01001                                 

Gene name
OR2B6, OR2B1, OR2B1P, OR2B5, OR2B6P, OR5-40, OR5-41, OR6-31, dJ408B20.2
Definition
(RefSeq) olfactory receptor family 2 subfamily B member 6
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26212 (OR2B6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26212 (OR2B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26212
NCBI-ProteinID: NP_036499
HGNC: 8241
Ensembl: ENSG00000124657
Vega: OTTHUMG00000014497
Pharos: P58173(Tdark)
UniProt: P58173 A0A126GW55
Position
6p22.1
AA seq 313 aa AA seqDB search
MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTIILVSRLDTKLHTPMY
FFLTNLSLLDLCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIFLALGATEYLLLAVMSF
DRFVAICRPLHYSVIMHQRLCLQLAAASWVTGFSNSVWLSTLTLQLPLCDPYVIDHFLCE
VPALLKLSCVETTANEAELFLVSELFHLIPLTLILISYAFIVRAVLRIQSAEGRQKAFGT
CGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGIIAPMLNPLIYTLRNKEVKEG
FKRLVARVFLIKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaattgggtaaatgacagcatcatacaggagtttattctgctgggtttctcagatcga
ccttggctggagtttccactccttgtggtcttcttgatttcttacactgtgaccatcttt
ggcaatctgaccattattctagtgtcacgcctggacaccaaacttcatacccccatgtat
ttttttcttaccaatctatcactcctggatctttgttacaccacatgtacagtcccacaa
atgctagtaaatttatgcagcatcaggaaagtaatcagttatcgtggctgtgtagcccag
cttttcatatttctggccttgggggctactgaatatcttctcctggccgtcatgtccttt
gataggtttgtagctatttgtcggcctctccattactcagttatcatgcaccagagactc
tgcctccagttggcagctgcatcctgggttactggttttagtaactcagtgtggttgtct
accctgactctccagctgccactctgtgacccctatgtgatagatcactttctctgtgaa
gtccctgcactgctcaagttatcttgtgttgagacaacagcaaatgaggctgaactattc
cttgtcagtgagctcttccatctaatacccctgacactcatccttatatcatatgctttt
attgtccgagcagtattgaggatacagtctgctgaaggtcgacaaaaagcatttgggaca
tgtggttcccatctaattgtggtgtctcttttttatagtacagccgtctctgtgtacctg
caaccaccttcgcccagctccaaggaccaaggaaagatggtttctctcttctatggaatc
attgcacccatgctgaatccccttatatatacacttaggaacaaggaggtaaaggaaggc
tttaaaaggttggttgcaagagtcttcttaatcaagaaataa

DBGET integrated database retrieval system