KEGG   Homo sapiens (human): 2622Help
Entry
2622              CDS       T01001                                 

Gene name
GAS8, CILD33, DRC4, GAS11
Definition
(RefSeq) growth arrest specific 8
  KO
K19942  growth arrest-specific protein 8
Organism
hsa  Homo sapiens (human)
Disease
H00564  Primary ciliary dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2622 (GAS8)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    2622 (GAS8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GAS
Motif
Other DBs
NCBI-GeneID: 2622
NCBI-ProteinID: NP_001472
OMIM: 605178
HGNC: 4166
Ensembl: ENSG00000141013
Vega: OTTHUMG00000138988
Pharos: O95995(Tbio)
UniProt: O95995 A0A384MR00
Position
16q24.3
AA seq 478 aa AA seqDB search
MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIH
TFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEG
TVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFER
QVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDI
TLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANY
ERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKT
GFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDL
QYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTPT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaaaaagaaagggaagaaaggcaaagccaaaggcaccccgattgtcgatggg
ctcgctccagaggacatgagcaaggagcaggtggaggagcatgtcagccgcatccgggag
gagctggaccgcgagcgggaggaacgaaactacttccagctggagcgggacaagatccac
accttctgggagatcacacggaggcagctggaggagaagaaggctgagctgcggaacaaa
gaccgggagatggaagaagccgaggagaggcaccaggtggagatcaaggtgtacaagcag
aaagtgaagcacctgctatatgagcaccagaacaacctgacagagatgaaggctgagggc
actgtagtcatgaagctggcacagaaagagcaccgcatacaggagagtgtgctgcgcaag
gacatgcgggcactgaaggtggagctcaaggagcaggagctggccagtgaggtggtggtg
aagaacctgcggctgaaacacaccgaggagatcaccaggatgcggaatgattttgagagg
caagttcgagaaattgaggccaagtatgataagaagatgaagatgctgagggacgaactc
gacttgcggagaaagactgagctccacgaagtggaggagaggaagaatggccagatccac
acgctgatgcagcgccacgaggaggccttcaccgacattaagaactactacaacgacatc
accctcaacaacctggccctcatcaactccctcaaggagcagatggaggacatgcggaag
aaggaggaccacctggagagggagatggcagaggtgtctgggcagaacaagcgcctggca
gaccctctccagaaggctcgggaggagatgagcgagatgcagaaacagctcgcaaactac
gagagggacaagcagatcctgctttgcacaaaagcccgtttgaaagtcagggagaaagag
ctgaaagacctgcagtgggagcatgaagtgttagagcagcgattcaccaaggtgcagcag
gagcgggacgagctctatcggaagttcaccgcagccatccaggaggtgcagcagaagaca
gggttcaagaacctcgtgctagaacgcaagctgcaggctctgagcgccgctgtggagaag
aaggaggtgcagttcaacgaggtcctggctgcctctaacctggaccctgcagccctgacg
ctggtgtcccgcaagctggaggatgttcttgagtcgaagaacagcaccatcaaggacctg
cagtatgagctggcccaggtctgtaaggcccataacgacctgctgcgcacgtatgaggca
aagctgctggccttcgggatccctctggacaacgtgggcttcaagcccttggaaacagct
gtgatcggacagacactgggccagggccccgcgggactggtgggcaccccgacgtag

DBGET integrated database retrieval system