KEGG   Homo sapiens (human): 26228
Entry
26228             CDS       T01001                                 

Gene name
STAP1, BRDG1, STAP-1
Definition
(RefSeq) signal transducing adaptor family member 1
  KO
K24025  signal-transducing adaptor protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    26228 (STAP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   26228 (STAP1)
SSDB
Motif
Pfam: PH SH2 SH2_2
Other DBs
NCBI-GeneID: 26228
NCBI-ProteinID: NP_001304698
OMIM: 604298
HGNC: 24133
Ensembl: ENSG00000035720
Vega: OTTHUMG00000129304
Pharos: Q9ULZ2(Tbio)
UniProt: Q9ULZ2 A0A024RD91
Structure
PDB: 
3MAZ 1X1F

Position
4q13.2
AA seq 295 aa
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDK
KSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatggctaagaagcccccaaaaccagcccctcgcaggatcttccaggaaaggttaaag
attactgctctacctttgtactttgaaggttttttattaatcaagcggtcaggataccgg
gagtatgagcattactggacagagttgagaggaactactcttttcttttataccgacaaa
aagagtataatatatgttgacaaattagacatagtagacctcacatgccttactgagcag
aattcaactgaaaagaactgtgcgaaattcacccttgttttgccgaaagaggaagtacaa
ctgaagacagagaacacagaaagtggggaagaatggagaggcttcattcttacagtaaca
gagctgtcagttccccaaaacgtgtcactcctacctgggcaagtaattaaactgcatgaa
gtcctagagagagaaaagaaaaggaggattgagacagagcagagtacgtccgtggaaaaa
gagaaggaaccaactgaagattatgtggatgtactgaaccctatgccagcatgtttttat
acagtgtcccggaaagaggcaactgagatgctccagaagaacccttctttgggaaatatg
atcctgaggcctggtagtgacagtagaaactactccatcactattcggcaggagatagac
attccaagaatcaagcactacaaagtgatgagcgtaggacaaaactacactattgaactg
gaaaaacctgtaacactcccaaaccttttcagtgtcattgattattttgtgaaggagact
cgaggaaatttaagaccatttatatgttcaactgatgaaaacactggtcaagaacccagt
atggaagggagaagtgaaaagttgaagaaaaatccacacattgcatga

DBGET integrated database retrieval system