KEGG   Homo sapiens (human): 26230Help
Entry
26230             CDS       T01001                                 

Gene name
TIAM2, STEF, TIAM-2
Definition
(RefSeq) TIAM Rac1 associated GEF 2
  KO
K16847  T-lymphoma invasion and metastasis-inducing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    26230 (TIAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tiam_CC_Ex RhoGEF PH PH_9 PDZ RBD PDZ_6 PH_6 PH_11 PDZ_2
Motif
Other DBs
NCBI-GeneID: 26230
NCBI-ProteinID: NP_036586
OMIM: 604709
HGNC: 11806
Ensembl: ENSG00000146426
Vega: OTTHUMG00000015880
Pharos: Q8IVF5(Tbio)
UniProt: Q8IVF5 B3KW11
Position
6q25.2-q25.3
AA seq 1701 aa AA seqDB search
MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSL
ARSCLSHFKSNQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVG
HELADNHITSRDCNGHLLNCYGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNG
GNPSKVPAEDCSEPVQLLRYSPTLASETSPVPEARRGSSADSLPSHRPSPTDSRLRSSKG
SSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHASFPPGDAKKPFNQSSSLSSLR
ELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDPIQYSSFTLPC
RKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV
QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETST
ETAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWV
TLKGCTLLFYETYGKNSMDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLF
QATSQTDLENWVTAVHSACASLFAKKHGKEDTLRLLKNQTKNLLQKIDMDSKMKKMAELQ
LSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPS
KLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKE
KRPSITQVDELLHIYGSTVDGVPRDNAWEIQTYVHFQDNHGVTVGIKPEHRVEDILTLAC
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQVYDEIEVFPLNVYDVQLTKTGSVC
DFGFAVTAQVDERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEAL
FSEKSVGLTLIARPPDTKATLCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTA
NDFSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFRSAEQITALCRSFNDSQANGMEGPR
ENQDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFLTQDEM
ESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYADHFKL
YSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTE
LSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPA
HNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQLCCSDS
ESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKN
SSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQDSKSTSPGKYPHPGLADFADN
LIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQK
GGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFSV
QSLTSVVSEECFYETESHGKS
NT seq 5106 nt NT seq  +upstreamnt  +downstreamnt
atgggcaactccgacagtcagtacacccttcaaggatctaaaaatcatagcaatactatt
actggtgctaagcaaattccttgctccctgaaaatacgtggcattcatgcaaaagaggaa
aagtcattgcatggatggggtcacggaagcaacggagcaggttacaagtccaggtccctg
gcccgaagctgcctttctcactttaagagtaaccagccttacgcatcgagactcggtggc
cccacatgcaaggtctccagaggtgttgcctactccacgcacaggacaaatgccccaggg
aaggatttccagggcatcagtgctgctttctcaactgagaatggcttccactctgttggc
cacgagctggcagataaccacatcacctccagagactgcaacggacaccttctcaactgc
tacgggaggaatgagagcattgcctccaccccaccgggcgaagaccgcaagagcccccga
gtgctcatcaaaacgctggggaagctggatgggtgtttaagggtcgagttccacaatggt
ggcaaccccagcaaagtgcctgcagaggactgcagtgagccggtgcagctgctgaggtac
tcacctaccttagcatcggaaacctcccctgtgcctgaagccaggagggggtccagcgcc
gattccctgcccagccatcgcccctctcccacggactctcgcctgcggtccagcaaaggc
agctccctgagttctgagtcatcctggtacgactccccttggggcaatgctggagagctg
agcgaggctgagggctccttcctggcccccggcatgcctgaccccagtctccatgccagc
ttcccacctggcgatgccaaaaagcctttcaaccaaagctcttccctctcctccctccgg
gaactgtacaaagatgccaacctggggagcctctccccctcaggtatccgcctttctgat
gaatacatgggcacgcatgccagcctgagcaaccgtgtctcttttgcttccgacattgat
gtgccctccagagtggcacacggggaccccatccagtacagttccttcactctcccctgt
cggaagcccaaagcctttgttgaggatactgcgaagaaggactccctcaaagccaggatg
cgacggatcagtgactggacgggaagcctctcaaggaagaaaaggaaactccaggagccg
aggtccaaggagggcagtgactactttgacagtcgctctgatggactgaatacagatgtg
cagggatcctcccaggcatctgcttttctgtggtcagggggctctactcagatcctgtct
cagagaagtgaatccacacatgcgattggcagcgatcccctccggcagaacatttatgag
aatttcatgcgagagttggaaatgagcaggaccaacactgagaacatagaaacatctaca
gaaaccgccgagtccagcagcgagtcactcagctctctggaacagctggatctgctcttt
gagaaggaacagggggtggtccggaaggccgggtggctcttcttcaagcccctggtcact
gtgcagaaggaaaggaagcttgagctggtggcacgaaggaaatggaaacagtactgggta
acgctgaaaggatgcacgctgctgttttatgagacctatgggaagaattccatggatcag
agcagtgcccctcggtgtgctctgtttgcagaagacagcatagtgcagtctgttccagag
catcccaagaaagaaaatgtgttctgcctcagcaactcctttggagatgtctaccttttc
caggccaccagccagacagatctagaaaactgggtcactgctgtacactctgcttgtgca
tccctttttgcaaagaagcatgggaaagaggacacgctgcggctgctgaagaaccagacc
aaaaacctgcttcagaagatagacatggacagcaagatgaagaagatggcagagctgcag
ctgtccgtggtgagcgacccaaagaacaggaaagccatagagaaccagatccagcaatgg
gagcagaatcttgagaaatttcacatggatctgttcaggatgcgctgctatctggccagc
ctacaaggtggggagttaccgaacccaaagagtctccttgcagccgccagccgcccctcc
aagctggccctcggcaggctgggcatcttgtctgtttcctctttccatgctctggtatgt
tctagagatgactctgctctccggaaaaggacactgtcactgacccagcgagggagaaac
aagaagggaatattttcttcgttaaaagggctggacacactggccagaaaaggcaaggag
aagagaccttctataactcaggtcgatgaacttctgcatatatatggttcaacagtagac
ggtgttccccgagacaatgcatgggaaatccagacttatgtccactttcaggacaatcac
ggagttactgtagggatcaagccagagcacagagtagaagatattttgactttggcatgc
aagatgaggcagttggaacccagccattatggcctacagcttcgaaaattagtagatgac
aatgttgagtattgcatccctgcaccatatgaatatatgcaacaacaggtttatgatgaa
atagaagtctttccactaaatgtttatgacgtgcagctcacgaagactgggagtgtgtgt
gactttgggtttgcagttacagcgcaggtggatgagcgtcagcatctcagccggatattt
ataagcgacgttcttcccgatggcctggcgtatggggaagggctgagaaagggcaatgag
atcatgaccttaaatggggaagctgtgtctgatcttgaccttaagcagatggaggccctg
ttttctgagaagagcgtcggactcactctgattgcccggcctccggacacaaaagcaacc
ctgtgtacatcctggtcagacagtgacctgttctccagggaccagaagagtctgctgccc
cctcctaaccagtcccaactgctggaggaattcctggataactttaaaaagaatacagcc
aatgatttcagcaacgtccctgatatcacaacaggtctgaaaaggagtcagacagatggc
actctggatcaggtttcccacagggagaaaatggagcagacattcaggagtgctgagcag
atcactgcactgtgcaggagttttaacgacagtcaggccaacggcatggaaggaccgcgg
gagaatcaggatcctcctccgaggcctctggcccgccacctgtctgatgcagaccgcctc
cgcaaagtcatccaggagcttgtggacacagagaagtcctacgtgaaggatttgagctgc
ctctttgaattatacttggagccacttcagaatgagacctttcttacccaagatgagatg
gagtcactttttggaagtttgccagagatgcttgagtttcagaaggtgtttctggagacc
ctggaggatgggatttcagcatcatctgactttaacaccctagaaaccccctcacagttt
agaaaattactgttttcccttggaggctctttcctttattacgcggaccactttaaactg
tacagtggattctgtgctaaccatatcaaagtacagaaggttctggagcgagctaaaact
gacaaagccttcaaggcttttctggacgcccggaaccccaccaagcagcattcctccacg
ctggagtcctacctcatcaagccggttcagagagtgctcaagtacccgctgctgctcaag
gagctggtgtccctgacggaccaggagagcgaggagcactaccacctgacggaagcacta
aaggcaatggagaaagtagcgagccacatcaatgagatgcagaagatctatgaggattat
gggaccgtgtttgaccagctagtagctgagcagagcggaacagagaaggaggtaacagaa
ctttcgatgggagagcttctgatgcactctacggtttcctggttgaatccatttctgtct
ctaggaaaagctagaaaggaccttgagctcacagtatttgtttttaagagagccgtcata
ctggtttataaagaaaactgcaaactgaaaaagaaattgccctcgaattcccggcctgca
cacaactctactgacttggacccatttaaattccgctggttgatccccatctccgcgctt
caagtcagactggggaatccagcagggacagaaaataattccatatgggaactgatccat
acgaagtcagaaatagaaggacggccagaaaccatctttcagttgtgttgcagtgacagt
gaaagcaaaaccaacattgttaaggtgattcgttctattctgagggagaacttcaggcgt
cacataaagtgtgaattaccactggagaaaacgtgtaaggatcgcctggtacctcttaag
aaccgagttcctgtttcggccaaattagcttcatccaggtctttaaaagtcctgaagaat
tcctccagcaacgagtggaccggtgagactggcaagggaaccttgctggactctgacgag
ggcagcttgagcagcggcacccagagcagcggctgccccacggctgagggcaggcaggac
tccaagagcacttctcccgggaaatacccacaccccggcttggcagattttgccgacaat
ctcatcaaagagagtgacatcctgagcgatgaagatgatgaccaccgtcagactgtgaag
cagggcagccctactaaagacatcgaaattcagttccagagactgaggatttccgaggac
ccagacgttcaccccgaggctgagcagcagcctggcccggagtcgggtgagggtcagaaa
ggaggagagcagcccaaactggtccgggggcacttctgccccattaaacgaaaagccaac
agcaccaagagggacagaggaactttgctcaaggcgcagatccgtcaccagtcccttgac
agtcagtctgaaaatgccaccatcgacctaaattctgttctagagcgagaattcagtgtc
cagagtttaacatctgttgtcagtgaggagtgtttttatgaaacagagagccacggaaaa
tcatag

DBGET integrated database retrieval system