KEGG   Homo sapiens (human): 26233
Entry
26233             CDS       T01001                                 
Symbol
FBXL6, FBL6, FBL6A, PP14630
Name
(RefSeq) F-box and leucine rich repeat protein 6
  KO
K10272  F-box and leucine-rich repeat protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26233 (FBXL6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26233 (FBXL6)
SSDB
Motif
Pfam: F-box-like LRR_4 LRR_6 F-box
Other DBs
NCBI-GeneID: 26233
NCBI-ProteinID: NP_036294
OMIM: 609076
HGNC: 13603
Ensembl: ENSG00000182325
Pharos: Q8N531(Tdark)
UniProt: Q8N531
Position
8:complement(144355431..144358472)
AA seq 539 aa
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEIL
VQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKK
LLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVM
LAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQL
QVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEE
LCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNL
RGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggctgccccagcctcccggcaggtccgacgcagagcccgggcagcgccgcggccccgc
tcggccgaggactggtggtgggaccggctggcgccgaggggctcggggtaccacctgctg
cagtccgacagcatgctgctggtgctgtccgaacccggccccgcccggccccgcgcacag
cggcgcgcttcccgccgcactccccggcagccgccccggggccccagcgccgcggccaag
cccaaggccgggctcaggtccgaggcggcggccgcgcccgcacccgcaccggcacccacg
cccacgcccgaggaagggcccgacgcgggctggggagaccgcattcccttggaaatcctg
gtgcagattttcgggttgttggtggcggcggacggccccatgcccttcctgggcagggct
gcgcgcgtgtgccgccgctggcaggaggccgcttcccaacccgcgctctggcacaccgtg
accctgtcgtccccgctggtcggccggcctgccaagggcggggtcaaggcggagaagaag
ctccttgcttccctggagtggcttatgcccaatcggttttcacagctccagaggctgacc
ctcatccactggaagtctcaggtacaccccgtgttgaagctggtaggtgagtgctgtcct
cggctcactttcctcaagctctccggctgccacggtgtgactgctgacgctctggtcatg
ctagccaaagcctgctgccagctccatagcctggacctacagcactccatggtggagtcc
acagctgtggtgagcttcttggaggaggcagggtcccgaatgcgcaagttgtggctgacc
tacagctcccagacgacagccatcctgggcgcactgctgggcagctgctgcccccagctc
caggtcctggaggtgagcaccggcatcaaccgtaatagcattccccttcagctgcctgtc
gaggctctgcagaaaggctgccctcagctccaggtgctgcggctgttgaacctgatgtgg
ctgcccaagcctccgggacgaggggtggctcccggaccaggcttccctagcctagaggag
ctctgcctggcgagctcaacctgcaactttgtgagcaacgaggtcctgggccgcctactc
cacggctctcccaacctgcgcttactggatcttcgtggctgtgcgcgcatcacgccggct
ggccttcaggatctgccatgtcgggagctggagcagcttcatctgggcctgtatggcacg
tcagaccggctgactctagccaaggagggcagcccctttttgacccagaagtggtgccat
acactgcgagaactggacttgagtggccaggggttcagtgagaaggacctggagcaggcc
ctggctgccttcttaagcacccctgggggctcacacccagccctgtgctctcttaacctc
aggggcacccgggtcacaccaagcactgtcagctctgtgatcagcggctgcccgggcctg
ctctacctcaacctggagtcctgccgctgccttccccggggtctgaagcgggcctaccgg
ggcctggaggaagtccagtggtgtctggagcagctgctcaccagcccctcacccagctag

DBGET integrated database retrieval system