KEGG   Homo sapiens (human): 2624Help
Entry
2624              CDS       T01001                                 

Gene name
GATA2, DCML, IMD21, MONOMAC, NFE1B
Definition
(RefSeq) GATA binding protein 2
  KO
K17894  GATA-binding protein 2
Organism
hsa  Homo sapiens (human)
Disease
H01481  Myelodysplastic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2624 (GATA2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    2624 (GATA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 2624
NCBI-ProteinID: NP_001139133
OMIM: 137295
HGNC: 4171
Ensembl: ENSG00000179348
Vega: OTTHUMG00000159689
Pharos: P23769(Tbio)
UniProt: P23769
Structure
PDB: 

Position
3q21.3
AA seq 480 aa AA seqDB search
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggcgcccgagcagccgcgctggatggcgcacccggccgtgctgaatgcgcag
caccccgactcacaccacccgggcctggcgcacaactacatggaacccgcgcagctgctg
cctccagacgaggtggacgtcttcttcaatcacctcgactcgcagggcaacccctactat
gccaaccccgctcacgcgcgggcgcgcgtctcctacagccccgcgcacgcccgcctgacc
ggaggccagatgtgccgcccacacttgttgcacagcccgggtttgccctggctggacggg
ggcaaagcagccctctctgccgctgcggcccaccaccacaacccctggaccgtgagcccc
ttctccaagacgccactgcacccctcagctgctggaggccctggaggcccactctctgtg
tacccaggggctgggggtgggagcgggggaggcagcgggagctcagtggcctccctcacc
cctacagcagcccactctggctcccaccttttcggcttcccacccacgccacccaaagaa
gtgtctcctgaccctagcaccacgggggctgcgtctccagcctcatcttccgcggggggt
agtgcagcccgaggagaggacaaggacggcgtcaagtaccaggtgtcactgacggagagc
atgaagatggaaagtggcagtcccctgcgcccaggcctagctactatgggcacccagcct
gctacacaccaccccatccccacctacccctcctatgtgccggcggctgcccacgactac
agcagcggactcttccaccccggaggcttcctggggggaccggcctccagcttcacccct
aagcagcgcagcaaggctcgttcctgttcagaaggccgggagtgtgtcaactgtggggcc
acagccacccctctctggcggcgggacggcaccggccactacctgtgcaatgcctgtggc
ctctaccacaagatgaatgggcagaaccgaccactcatcaagcccaagcgaagactgtcg
gccgccagaagagccggcacctgttgtgcaaattgtcagacgacaaccaccaccttatgg
cgccgaaacgccaacggggaccctgtctgcaacgcctgtggcctctactacaagctgcac
aatgttaacaggccactgaccatgaagaaggaagggatccagactcggaaccggaagatg
tccaacaagtccaagaagagcaagaaaggggcggagtgcttcgaggagctgtcaaagtgc
atgcaggagaagtcatcccccttcagtgcagctgccctggctggacacatggcacctgtg
ggccacctcccgcccttcagccactccggacacatcctgcccactccgacgcccatccac
ccctcctccagcctctccttcggccacccccacccgtccagcatggtgaccgccatgggc
tag

DBGET integrated database retrieval system