KEGG   Homo sapiens (human): 26240Help
Entry
26240             CDS       T01001                                 

Gene name
FAM50B, D6S2654E, X5L
Definition
(RefSeq) family with sequence similarity 50 member B
  KO
K13119  protein FAM50
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    26240 (FAM50B)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    26240 (FAM50B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XAP5
Motif
Other DBs
NCBI-GeneID: 26240
NCBI-ProteinID: NP_036267
OMIM: 614686
HGNC: 18789
Ensembl: ENSG00000145945 ENSG00000238158
Vega: OTTHUMG00000014147
Pharos: Q9Y247(Tdark)
UniProt: Q9Y247 A0A024QZY3
Position
6p25.2
AA seq 325 aa AA seqDB search
MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAEL
KSSTVGLVTLNDMKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCL
SFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAQREKV
KDEEMEVTFSYWDGSGHRRTVRVRKGNTVQQFLKKALQGLRKDFLELRSAGVEQLMFIKE
DLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEK
NKHIFPASRWEAYDPEKKWDKYTIR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtacaagggcaccatgcgcgaggcaggccgtgccatgcacctcctcaagaag
cgcgaaaggcagcgggagcagatggaggtgctgaagcagcgcatcgccgaggagaccatc
ctcaagtcgcaggtggacaagaggttctcggcgcattacgacgccgtggaggccgagctg
aagtccagcacggtgggcctggtgaccctgaacgacatgaaggcccggcaggaggccctg
gtcagggagcgcgagcggcagctggccaagcgccagcacctggaggagcagcggctgcag
caggagcggcagcgggagcaggagcagcggcgcgagcgcaagcgtaagatctcctgcctg
tcctttgcactagacgacctcgatgaccaggccgacgcggccgaggccaggcgcgccgga
aacctgggcaagaaccccgacgtggacaccagcttcctgccagaccgcgaccgcgaggag
gaggagaaccggctccgagaggagctgcgccaagagtgggaggcgcagcgcgagaaagtg
aaggacgaggagatggaggtcaccttcagctactgggacggctcgggccaccggcgcacg
gtgcgggtgcgcaagggcaacacggtgcagcagttcctgaagaaggcgctgcaggggctg
cgcaaggacttcctggagctgcgctccgccggcgtggagcagctcatgttcatcaaggag
gacctcatcctgccgcactaccacaccttctacgacttcatcatcgccagggcgaggggc
aagagcgggccgctcttcagcttcgatgtgcacgatgacgtgcgcctgctcagcgacgcc
accatggagaaggacgagtcgcacgcgggcaaggtggtgctgcgcagctggtacgagaag
aacaagcacatcttccccgccagccgctgggaggcctatgaccccgagaagaagtgggac
aagtacaccatccgctaa

DBGET integrated database retrieval system