KEGG   Homo sapiens (human): 26245
Entry
26245             CDS       T01001                                 
Symbol
OR2M4, HSHTPCRX18, HTPCRX18, OR1-55, OST710, TPCR100
Name
(RefSeq) olfactory receptor family 2 subfamily M member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26245 (OR2M4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26245 (OR2M4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26245 (OR2M4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx VMA21
Other DBs
NCBI-GeneID: 26245
NCBI-ProteinID: NP_059974
HGNC: 8270
Ensembl: ENSG00000171180
Pharos: Q96R27(Tdark)
UniProt: Q96R27 A0A126GV73
Position
1:248231417..248244679
AA seq 311 aa
MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMY
FLLSQLSLMDLMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAY
DRYVAICHPLQYTILMNPKLCVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCD
VAALLPLSCTETSAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTT
CSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTILTPMLNPLIYSLRNKEVFRA
LQKVLKKRKLI
NT seq 936 nt   +upstreamnt  +downstreamnt
atggtgtgggaaaaccagaccttcaactccatcttcatcctgctgggaatcttcaatcac
agtcccacccacaccttccttttttctctggtcctgggcatcttctcactggcattgatg
gaaaatatttccatggttctcctcatctacatagagaaacagctccacacccccatgtac
ttcctcctcagtcaactgtcccttatggacctcatgctcatctgcaccactctacccaag
atgatcttcagctacttgtctgggaagaaatctatctctctggcaggttgtggaactcag
atattcttctatgtgtccctgcttggagctgaatgtttcttgttggctgtcatggcttat
gaccgctatgtggctatatgtcaccctcttcagtacaccatcctcatgaatccgaaactc
tgtgtcttcatgactgttgcttcctggaccttggggtctcttgatgggatcatagtgctt
gcagctgtcctgtcattttcttactgcagctctctggaaattcatcactttttctgtgat
gttgctgcccttttacctctatcctgcacagaaacatctgcatttgaaagactacttgtc
atttgttgtgtggtaatgctaatctttccagtttcagttatcatactttcctattcccat
gtccttcgagccgtcatccacatgggctctggggaaagtcgtcgcaaggccttcactacc
tgctcctcccacctgtctgtggtcggactctactacggtgctgctatgttcatgtacatg
agaccagcttctaaacatacgccagaccaggacaagatggtgtcggccttctacactatt
ctcacccctatgctgaaccctctcatttatagcctccgcaacaaagaagtgttcagggca
ctacagaaggtactgaagaaaagaaagttaatatga

DBGET integrated database retrieval system