KEGG   Homo sapiens (human): 2625Help
Entry
2625              CDS       T01001                                 

Gene name
GATA3, HDR, HDRS
Definition
(RefSeq) GATA binding protein 3
  KO
K17895  GATA-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05321  Inflammatory bowel disease (IBD)
Disease
H01271  Hypoparathyroidism with sensorineural deafness and renal dysplasia
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    2625 (GATA3)
   04659 Th17 cell differentiation
    2625 (GATA3)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    2625 (GATA3)
 09160 Human Diseases
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    2625 (GATA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2625 (GATA3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    2625 (GATA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA TF_Zn_Ribbon Auto_anti-p27 Prim_Zn_Ribbon OrfB_Zn_ribbon
Motif
Other DBs
NCBI-GeneID: 2625
NCBI-ProteinID: NP_002042
OMIM: 131320
HGNC: 4172
Ensembl: ENSG00000107485
Vega: OTTHUMG00000017640
Pharos: P23771(Tbio)
UniProt: P23771
Structure
PDB: 

Position
10p14
AA seq 443 aa AA seqDB search
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT
PMHPPSSLSFGPHHPSSMVTAMG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgccgtgctcaac
gggcagcacccggacacgcaccacccgggcctcagccactcctacatggacgcggcgcag
tacccgctgccggaggaggtggatgtgctttttaacatcgacggtcaaggcaaccacgtc
ccgccctactacggaaactcggtcagggccacggtgcagaggtaccctccgacccaccac
gggagccaggtgtgccgcccgcctctgcttcatggatccctaccctggctggacggcggc
aaagccctgggcagccaccacaccgcctccccctggaatctcagccccttctccaagacg
tccatccaccacggctccccggggcccctctccgtctaccccccggcctcgtcctcctcc
ttgtcggggggccacgccagcccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctccccggacccatcgctgtccaccccaggctcggccggctcggcccggcaggacgag
aaagagtgcctcaagtaccaggtgcccctgcccgacagcatgaagctggagtcgtcccac
tcccgtggcagcatgaccgccctgggtggagcctcctcgtcgacccaccaccccatcacc
acctacccgccctacgtgcccgagtacagctccggactcttcccccccagcagcctgctg
ggcggctcccccaccggcttcggatgcaagtccaggcccaaggcccggtccagcacaggc
agggagtgtgtgaactgtggggcaacctcgaccccactgtggcggcgagatggcacggga
cactacctgtgcaacgcctgcgggctctatcacaaaatgaacggacagaaccggcccctc
attaagcccaagcgaaggctgtctgcagccaggagagcagggacgtcctgtgcgaactgt
cagaccaccacaaccacactctggaggaggaatgccaatggggaccctgtctgcaatgcc
tgtgggctctactacaagcttcacaatattaacagacccctgactatgaagaaggaaggc
atccagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaagtgcatgac
tcactggaggacttccccaagaacagctcgtttaacccggccgccctctccagacacatg
tcctccctgagccacatctcgcccttcagccactccagccacatgctgaccacgcccacg
ccgatgcacccgccatccagcctgtcctttggaccacaccacccctccagcatggtcacc
gccatgggttag

DBGET integrated database retrieval system