KEGG   Homo sapiens (human): 26253Help
Entry
26253             CDS       T01001                                 

Gene name
CLEC4E, CLECSF9, MINCLE
Definition
(RefSeq) C-type lectin domain family 4 member E
  KO
K10059  C-type lectin domain family 4 member E
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    26253 (CLEC4E)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    26253 (CLEC4E)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   26253 (CLEC4E)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    26253 (CLEC4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 26253
NCBI-ProteinID: NP_055173
OMIM: 609962
HGNC: 14555
Ensembl: ENSG00000166523
Vega: OTTHUMG00000168675
Pharos: Q9ULY5(Tbio)
UniProt: Q9ULY5
Structure
PDB: 

Position
12p13.31
AA seq 219 aa AA seqDB search
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLP
ENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS
QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCA
TMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatctaaatcatctgaaacacaatgcacagagagaggatgcttctcttcccaa
atgttcttatggactgttgctgggatccccatcctatttctcagtgcctgtttcatcacc
agatgtgttgtgacatttcgcatctttcaaacctgtgatgagaaaaagtttcagctacct
gagaatttcacagagctctcctgctacaattatggatcaggttcagtcaagaattgttgt
ccattgaactgggaatattttcaatccagctgctacttcttttctactgacaccatttcc
tgggcgttaagtttaaagaactgctcagccatgggggctcacctggtggttatcaactca
caggaggagcaggaattcctttcctacaagaaacctaaaatgagagagttttttattgga
ctgtcagaccaggttgtcgagggtcagtggcaatgggtggacggcacacctttgacaaag
tctctgagcttctgggatgtaggggagcccaacaacatagctaccctggaggactgtgcc
accatgagagactcttcaaacccaaggcaaaattggaatgatgtaacctgtttcctcaat
tattttcggatttgtgaaatggtaggaataaatcctttgaacaaaggaaaatctctttaa

DBGET integrated database retrieval system