KEGG   Homo sapiens (human): 26254Help
Entry
26254             CDS       T01001                                 

Gene name
OPTC, OPT
Definition
(RefSeq) opticin
  KO
K08128  opticin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    26254 (OPTC)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    26254 (OPTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 26254
NCBI-ProteinID: NP_055174
OMIM: 605127
HGNC: 8158
Ensembl: ENSG00000188770
Vega: OTTHUMG00000036100
Pharos: Q9UBM4(Tbio)
UniProt: Q9UBM4
Position
1q32.1
AA seq 332 aa AA seqDB search
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVI
DLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQ
PNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLK
RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQP
AAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQ
LEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcctggctttcctgagtctgctggccttggtgctgcaggagacagggacagct
tctctcccaaggaaggagaggaagaggagagaggagcagatgcccagggaaggcgattcc
tttgaagttctgcctctgcggaatgatgtcctgaacccagacaactatggtgaagtcatt
gacctgagcaactatgaggagctcacagattatggggaccaactccccgaggttaaggtg
actagcctcgctcctgcaaccagcatcagtcccgccaagagcactacggctccagggaca
ccctcgtcaaaccccacgatgaccagacctactacagcagggctgctactgagttcccag
cccaaccatggtctgcccacctgcctggtctgcgtgtgcctcggttcctctgtgtattgc
gatgacattgacctagaggacattcctcctcttcctcggaggactgcctacctgtatgca
cgcttcaaccgcatcagccgtatcagggccgaagacttcaaagggctgacaaagttgaag
aggattgacctctccaacaacctcatttcctccatcgataatgatgccttccgcctgcta
catgccctccaggacctcatcctcccagagaaccagttggaagctctgcccgtgctgccc
agtggcattgagttcctggatgtccgcctaaatcggctccagagctcggggatacagcct
gcagccttcagggcaatggagaagctgcagttcctttacctgtcagacaacctgctggat
tctatcccggggcctttgcccctgagcctgcgctctgtacacctgcagaataacctgata
gagaccatgcagagagacgtcttctgtgaccccgaggagcacaaacacacccgcaggcag
ctggaagacatccgcctggatggcaaccccatcaacctcagcctcttccccagcgcctac
ttctgcctgcctcggctccccatcggccgcttcacgtag

DBGET integrated database retrieval system