KEGG   Homo sapiens (human): 26256
Entry
26256             CDS       T01001                                 
Symbol
CABYR, CABYRa, CABYRc, CABYRc/d, CABYRe, CBP86, CT88, FSP-2, FSP2
Name
(RefSeq) calcium binding tyrosine phosphorylation regulated
  KO
K25629  calcium-binding tyrosine phosphorylation-regulated protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    26256 (CABYR)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   26256 (CABYR)
SSDB
Motif
Pfam: RIIa
Other DBs
NCBI-GeneID: 26256
NCBI-ProteinID: NP_036321
OMIM: 612135
HGNC: 15569
Ensembl: ENSG00000154040
Pharos: O75952(Tbio)
UniProt: O75952 A0A024RC21
Position
18:24139062..24161600
AA seq 493 aa
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQML
GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTS
VHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDV
PVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSV
ESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE
VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLT
APEIEPEGESTAE
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgatttcttcaaagcccagacttgtcgtaccctatggcctcaagactctgctcgaggga
attagcagagctgttctcaaaaccaacccatcaaacatcaaccagtttgcagcagcttat
tttcaagaacttactatgtatagagggaatactactatggatataaaagatctggttaaa
caatttcatcagattaaagtagagaaatggtcagaaggaacgacaccacagaagaaatta
gaatgtttaaaagaaccaggaaaaacatctgtagaatctaaagtacctacccagatggaa
aaatctacagacacagacgaggacaatgtaaccagaacagaatatagtgacaaaaccacc
cagtttccatcagtttatgctgtgccaggcactgagcaaacggaagcagttggtggtctt
tcttccaaaccagccacccctaagactactaccccaccctcatcaccacctccaacagct
gtctcaccagagtttgcctacgtcccagctgacccagctcagcttgctgctcagatgtta
ggtaaagtttcatctattcattctgatcaatctgatgtgttaatggtggatgtggcaacc
agtatgcctgttgttatcaaggaggtgccaagctcagaggctgctgaagatgtcatggtg
gctgctcctcttgtgtgttctggaaaggtgctagaagtgcaggttgtgaaccaaacatct
gtccatgtagatttgggttctcaacctaaagaaaatgaggctgaaccatcaacggcttcc
tcagtccccttgcaggatgaacaagaacctcctgcttatgatcaagctcctgaggtcact
ttgcaggctgatattgaggttatgtcaactgttcatatatcatctgtctataacgatgtg
cctgtgactgaaggagttgtttatatcgagcaactgccagaacaaatagttatccctttt
actgatcaagttgcttgtcttaaagaaaatgagcagtcaaaagaaaatgagcagtcacca
cgagttagtcccaaatctgtagtagaaaagaccacctctggcatgtctaaaaaatctgta
gagtctgtaaaacttgcacagttggaggagaatgcaaaatattcctcagtatatatggag
gcagaagcaacagctctgctctctgacacatctttgaaaggtcagcctgaggtacctgca
caactcctggatgcagaaggtgctatcaaaataggctctgaaaaatctctgcaccttgaa
gtggagatcacttcaatagtctctgacaatactgggcaggaggagtctggggaaaactct
gtaccccaggagatggaaggcaaacctgtgctctctggggaagctgcagaagcagtgcac
tcaggtacatctgtaaagtcatctagtggccccttccctcctgctccagaaggccttact
gcaccagaaattgaaccagaaggggaatcaacagctgaataa

DBGET integrated database retrieval system