KEGG   Homo sapiens (human): 26261Help
Entry
26261             CDS       T01001                                 

Gene name
FBXO24, FBX24
Definition
(RefSeq) F-box protein 24
  KO
K10304  F-box protein 24
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26261 (FBXO24)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26261 (FBXO24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box RCC1 F-box_4
Motif
Other DBs
NCBI-GeneID: 26261
NCBI-ProteinID: NP_277041
OMIM: 609097
HGNC: 13595
Ensembl: ENSG00000106336
Vega: OTTHUMG00000159543
Pharos: O75426(Tdark)
UniProt: O75426 A4D2D3
Position
7q22.1
AA seq 580 aa AA seqDB search
MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLV
ALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGR
RRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVL
CRGAKDFASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCVEVYLQSSGQRVFKMTF
HHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPH
LRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKIL
FCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPITLWCGLNHSL
VLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSH
DIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRTEKMK
EIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaaggcggtccctttgctaaggaggaggcgggtgaagagaagctgcccttct
tgtggctcggagcttggggttgaagagaagagggggaaaggaaatccgatttccatccag
ttgttccccccagagctggtggagcatatcatctcattcctcccagtcagagaccttgtt
gccctcggccagacctgccgctacttccacgaagtgtgcgatggggaaggcgtgtggaga
cgcatctgtcgcagactcagtccgcgcctccaagatcagggttctggagtccggccctgg
aagagagctgccattctgaactacacgaagggcctgtatttccaggcatttggaggccgc
cgccgatgtctcagcaagagcgtggcccccttgctagcccacggctaccgccgcttcttg
cccaccaaggatcacgtcttcattcttgactacgtggggaccctcttcttcctcaaaaat
gccctggtctccaccctcggccagatgcagtggaagcgggcctgtcgctatgttgtgttg
tgtcgtggagccaaggattttgcctcggacccaaggtgtgacacagtttaccgtaaatac
ctctacgtcttggccactcgggagccgcaggaagtggtgggtaccaccagcagccgggcc
tgtgactgtgttgaggtctatctgcagtctagtgggcagcgggtcttcaagatgacattc
caccactcaatgaccttcaagcagatcgtgctggttggtcaggagacccagcgggctcta
ctgctcctcacagaggaaggaaagatctactctttggtagtgaatgagacccagcttgac
cagccacgctcctacacggttcagctggccctgaggaaggtgtcccactacctgcctcac
ctgcgcgtggcctgcatgacttccaaccagagcagcaccctctacgtcacagaccagggg
ggagtgtattttgaggtgcataccccaggggtgtatcgcgatctctttgggacccttcaa
gcctttgaccccctggaccagcagatgccgcttgctctctcactgcctgccaagatccta
ttctgtgctcttggctacaaccaccttggcctggtggatgaatttggccgaatcttcatg
caaggaaataacagatacgggcagctaggaacaggggacaaaatggaccgaggggaaccc
acacaggtttgttacctgcagcggcccatcaccctgtggtgcggcctcaaccactccctg
gtgctgagccagagctcagagttcagcaaggagctgctgggctgcggctgtggggctggg
ggccgcctcccaggctggcccaaggggagtgcctccttcgtcaagctccaagtcaaggtc
cctctgtgtgcctgtgccctctgtgccaccagggagtgcctatacatcctgtccagccac
gacattgagcagcacgccccctatcgccacctgccagccagcagggtggtggggactcct
gagcccagcctgggggccagagcaccccaggaccccggggggatggcccaggcctgcgag
gagtacctcagccagatccacagttgccaaacgttgcaggaccgcacggagaagatgaag
gagatcgtagggtggatgcccctgatggccgcacagaaggacttcttctgggaggccctg
gacatgctgcagagggctgaaggaggcgggggtggtgtagggcccccagcccctgagacc
taa

DBGET integrated database retrieval system