KEGG   Homo sapiens (human): 26268
Entry
26268             CDS       T01001                                 
Symbol
FBXO9, FBX9, NY-REN-57, VCIA1, dJ341E18.2
Name
(RefSeq) F-box protein 9
  KO
K10295  F-box protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26268 (FBXO9)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26268 (FBXO9)
SSDB
Motif
Pfam: FBO_C F-box-like F-box MIT PRTRC_E TPR_2 TPR_1
Other DBs
NCBI-GeneID: 26268
NCBI-ProteinID: NP_036479
OMIM: 609091
HGNC: 13588
Ensembl: ENSG00000112146
Pharos: Q9UK97(Tbio)
UniProt: Q9UK97
Position
6:53057802..53100873
AA seq 447 aa
MPDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSS
SNLENRPCRAARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGALYEAIKFYRRA
MQLVPDIEFKITYTRSPDGDGVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPE
LESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARDPEIWRLACLKV
WGRSCIKLVPYTSWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYI
RFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVITKKKE
EKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVS
AFEIDKMYTPLFFARVRSYTAFSERPL
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgcctgacattatttgggttttcccccctcaggcagaagctgaggaagattgtcattct
gatactgtcagagcagatgatgatgaagaaaatgaaagtcctgctgaaacagatctgcag
gcacaactccagatgttccgagctcagtggatgtttgaacttgctccaggtgtaagctct
agcaatttagaaaatcgaccttgcagagcagcaagaggctctctccagaaaacatcggca
gataccaaaggaaaacaagaacaggcaaaagaagaaaaggctcgagaactcttcctaaaa
gcagtagaagaagaacaaaatggagctctctatgaagccatcaagttttatcgtagggct
atgcaacttgtacctgatatagagttcaagattacttatacccggtctccagatggtgat
ggcgttggaaacagctacattgaagataatgatgatgacagcaaaatggcagatctcttg
tcctacttccagcagcaactcacatttcaggagtctgtgcttaaactgtgtcagcctgag
cttgagagcagtcagattcacatatcagtgctgccaatggaggtcctgatgtacatcttc
cgatgggtggtgtctagtgacttggacctcagatcattggagcagttgtcgctggtgtgc
agaggattctacatctgtgccagagaccctgaaatatggcgtctggcctgcttgaaagtt
tggggcagaagctgtattaaacttgttccgtacacgtcctggagagagatgtttttagaa
cggcctcgtgttcggtttgatggcgtgtatatcagtaaaaccacatatattcgtcaaggg
gaacagtctcttgatggtttctatagagcctggcaccaagtggaatattacaggtacata
agattctttcctgatggccatgtgatgatgttgacaacccctgaagagcctcagtccatt
gttccacgtttaagaactaggaataccaggactgatgcaattctactgggtcactatcgc
ttgtcacaagacacagacaatcagaccaaagtatttgctgtaataactaagaaaaaagaa
gaaaaaccacttgactataaatacagatattttcgtcgtgtccctgtacaagaagcagat
cagagttttcatgtggggctacagctatgttccagtggtcaccagaggttcaacaaactc
atctggatacatcattcttgtcacattacttacaaatcaactggtgagactgcagtcagt
gcttttgagattgacaagatgtacacccccttgttcttcgccagagtaaggagctacaca
gctttctcagaaaggcctctgtag

DBGET integrated database retrieval system