KEGG   Homo sapiens (human): 26270Help
Entry
26270             CDS       T01001                                 

Gene name
FBXO6, FBG2, FBS2, FBX6, Fbx6b
Definition
(RefSeq) F-box protein 6
  KO
K10100  F-box protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26270 (FBXO6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26270 (FBXO6)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    26270 (FBXO6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26270 (FBXO6)
Lectins [BR:hsa04091]
 F-box lectins
  26270 (FBXO6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 26270
NCBI-ProteinID: NP_060908
OMIM: 605647
HGNC: 13585
Ensembl: ENSG00000116663
Vega: OTTHUMG00000002229
Pharos: Q9NRD1(Tbio)
UniProt: Q9NRD1
Position
1p36.22
AA seq 293 aa AA seqDB search
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQ
YWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggatgctccccactccaaagcagccctggacagcattaacgagctgcccgagaacatc
ctgctggagctgttcacgcacgtgcccgcccgccagctgctgctgaactgccgcctggtc
tgcagcctctggcgggacctcatcgacctcatgaccctctggaaacgcaagtgcctgcga
gagggcttcatcaccaaggactgggaccagcccgtggccgactggaaaatcttctacttc
ctacggagcctgcataggaacctcctgcgcaacccgtgtgctgaagaggatatgtttgca
tggcaaattgatttcaatggtggggaccgctggaaggtggagagcctccctggagcccac
gggacagattttcctgaccccaaagtcaagaagtattttgtcacatcctacgaaatgtgc
ctcaagtcccagctggtggaccttgtagccgagggctactgggaggagctactagacaca
ttccggccggacatcgtggttaaggactggtttgctgccagagccgactgtggctgcacc
taccaactcaaagtgcagctggcctcggctgactacttcgtgttggcctccttcgagccc
ccacctgtgaccatccaacagtggaacaatgccacatggacagaggtctcctacaccttc
tcagactacccccggggtgtccgctacatcctcttccagcatgggggcagggacacccag
tactgggcaggctggtatgggccccgagtcaccaacagcagcattgtcgtcagccccaag
atgaccaggaaccaggcctcctccgaggctcagcctgggcagaagcatggacaggaggag
gctgcccaatcgccctaccgagctgttgtccagattttctga

DBGET integrated database retrieval system