KEGG   Homo sapiens (human): 2628Help
Entry
2628              CDS       T01001                                 

Gene name
GATM, AGAT, AT, CCDS3
Definition
(RefSeq) glycine amidinotransferase
  KO
K00613  glycine amidinotransferase [EC:2.1.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Disease
H00849  Cerebral creatine deficiency syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    2628 (GATM)
   00330 Arginine and proline metabolism
    2628 (GATM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.1  glycine amidinotransferase
     2628 (GATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-GeneID: 2628
NCBI-ProteinID: NP_001473
OMIM: 602360
HGNC: 4175
Ensembl: ENSG00000171766
Vega: OTTHUMG00000131427
Pharos: P50440(Tbio)
UniProt: P50440 A0A140VK19
Structure
PDB: 

Position
15q21.1
AA seq 423 aa AA seqDB search
MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPL
PKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHL
KKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEII
EAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAA
QGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
PMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSM
NVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS
YLD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggtgcggtgtctgcgcggcgggagccgcggcgccgaggcggtgcactacatc
ggatctcggcttggacgaaccttgacaggatgggtgcagcgaactttccagagcacccag
gcagctacggcttcctcccggaactcctgtgcagctgacgacaaagccactgagcctctg
cccaaggactgccctgtctcttcttacaacgaatgggaccccttagaggaagtgatagtg
ggcagagcagaaaacgcctgtgttccaccgttcaccatcgaggtgaaggccaacacatat
gaaaagtactggccattttaccagaagcaaggagggcattattttcccaaagatcatttg
aaaaaggctgttgctgaaattgaagaaatgtgcaatattttaaaaacggaaggagtgaca
gtaaggaggcctgaccccattgactggtcattgaagtataaaactcctgattttgagtct
acgggtttatacagtgcaatgcctcgagacatcctgatagttgtgggcaatgagattatc
gaggctcccatggcatggcgttcacgcttctttgagtaccgagcgtacaggtcaattatc
aaagactacttccaccgtggcgccaagtggacaacagctcctaagcccacaatggctgat
gagctttataaccaggattatcccatccactctgtagaagacagacacaaattggctgct
cagggaaaatttgtgacaactgagtttgagccatgctttgatgctgctgacttcattcga
gctggaagagatatttttgcacagagaagccaggttacaaactacctaggcattgaatgg
atgcgtaggcatcttgctccagactacagagtgcatatcatctcctttaaagatcccaat
cccatgcatattgatgctaccttcaacatcattggacctggtattgtgctttccaaccct
gaccgaccatgtcaccagattgatcttttcaagaaagcaggatggactatcattactcct
ccaacaccaatcatcccagacgatcatccactctggatgtcatccaaatggctttccatg
aatgtcttaatgctagatgaaaaacgtgttatggtggatgccaatgaagttccaattcaa
aagatgtttgaaaagctgggtatcactaccattaaagttaacattcgtaatgccaattcc
ctgggaggaggcttccattgctggacctgcgatgtccggcgccgaggcaccttacagtcc
tacttggactga

DBGET integrated database retrieval system