KEGG   Homo sapiens (human): 26280Help
Entry
26280             CDS       T01001                                 

Gene name
IL1RAPL2, IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1
Definition
(RefSeq) interleukin 1 receptor accessory protein like 2
  KO
K05170  interleukin 1 receptor accessory protein-like
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26280 (IL1RAPL2)
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    26280 (IL1RAPL2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    26280 (IL1RAPL2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   26280 (IL1RAPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_2 Ig_6 I-set Ig_3 ig V-set TIR_2 V-set_CD47 Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 26280
NCBI-ProteinID: NP_059112
OMIM: 300277
HGNC: 5997
Ensembl: ENSG00000189108
Vega: OTTHUMG00000022141
Pharos: Q9NP60(Tbio)
UniProt: Q9NP60
Position
Xq22.3
AA seq 686 aa AA seqDB search
MKPPFLLALVVCSVVSTNLKMVSKRNSVDGCIDWSVDLKTYMALAGEPVRVKCALFYSYI
RTNYSTAQSTGLRLMWYKNKGDLEEPIIFSEVRMSKEEDSIWFHSAEAQDSGFYTCVLRN
STYCMKVSMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDVVWY
KECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEGKLVRRTTELKVTALLTDKPP
KPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEI
RLLKEHLGEKEVELALIFDSVVEADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGG
LGAIFLLLVLLVVIYKCYNIELMLFYRQHFGADETNDDNKEYDAYLSYTKVDQDTLDCDN
PEEEQFALEVLPDVLEKHYGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYIL
RRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSIKLLSLIKWKGSK
SSKLNSKFWKHLVYEMPIKKKEMLPRCHVLDSAEQGLFGELQPIPSIAMTSTSATLVSSQ
ADLPEFHPSDSMQIRHCCRGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLK
DTQEFHRNSSLLPLSSKELSFTSDIW
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaccatttcttttggcccttgtggtctgttctgtagtcagcacaaatctgaag
atggtgtcaaagagaaattctgtggatggctgcattgactggtcagtggatctcaagaca
tacatggctttggcaggtgaaccagtccgagtgaaatgtgcccttttctacagttatatt
cgtaccaactatagcacggcccagagcactgggctcaggcttatgtggtacaaaaacaaa
ggtgatttggaagagcccatcatcttttcagaggtcaggatgagcaaagaggaagattca
atatggtttcactcagctgaggcacaagacagtggattctacacttgtgttttaagaaac
tcaacatattgcatgaaggtgtcaatgtccttgactgttgcagagaatgaatcaggcctg
tgctacaacagcaggatccgctatttagaaaaatctgaagtcactaaaagaaaggagatc
tcctgtccagacatggatgactttaaaaagtccgatcaggagcctgatgttgtgtggtat
aaggaatgcaagccaaaaatgtggagaagcataataatacagaaaggaaatgctcttctg
atccaagaagttcaagaagaagatggaggaaattacacatgtgaacttaaatatgaagga
aaacttgtaagacgaacaactgaattgaaagttacagctttactcacagacaagcctccc
aagccattgttccccatggagaatcagccaagtgttatagatgtccagctgggtaagcct
ctgaacatcccctgcaaagcattcttcggattcagtggagagtctgggccaatgatctac
tggatgaaaggagaaaagtttattgaagaactggcaggtcacattagagaaggtgaaata
aggcttctcaaagagcatcttggagaaaaagaagttgaattggcactcatctttgactca
gttgtggaagctgacctggcgaattatacctgccatgttgaaaaccgaaatggacggaaa
catgccagtgttttgctgcgtaaaaaggatttaatctataaaattgagcttgcagggggc
ctgggagcaatcttcctcctccttgtactgctggtggtcatttacaaatgctacaacatt
gaattgatgctcttctacaggcagcactttggagctgatgaaactaatgatgacaacaag
gaatatgatgcctatctctcttacacaaaagtggaccaagatactttagactgtgacaat
cctgaagaagagcagtttgctcttgaagtactgccagatgtcctggaaaaacactatgga
tataaactcttcatcccagaaagagacctgattccaagtggaacatacatggaagatctc
acaagatatgttgaacaaagcagaagacttattatcgtgctaactccagactatattctc
agacggggatggagtattttcgaactggaaagcagactccataacatgctagtcagtgga
gaaatcaaagtgattttgattgagtgtacagaattaaaagggaaagtgaattgccaggaa
gtggaatcactaaagcgtagcatcaaacttctgtccctgatcaagtggaagggatccaaa
agcagcaaattaaattctaagttttggaagcacttagtatatgaaatgcccatcaagaaa
aaagaaatgctacctcggtgccatgttctggactccgcagaacaaggactttttggagaa
ctccagcctataccctctattgccatgaccagtacttcagccactctggtgtcatctcag
gctgatctccctgaattccacccttcagattcaatgcaaatcaggcactgttgcagaggt
tataaacatgagataccagccacgaccttgccagtaccttccttaggcaaccaccatact
tattgtaacctgcctctgacgctactcaacggacagctaccccttaataacaccctgaaa
gatacccaggaatttcacaggaacagttctttgctgcctttatcctccaaagagcttagc
tttaccagtgatatttggtag

DBGET integrated database retrieval system