KEGG   Homo sapiens (human): 26285Help
Entry
26285             CDS       T01001                                 

Gene name
CLDN17
Definition
(RefSeq) claudin 17
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    26285 (CLDN17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    26285 (CLDN17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    26285 (CLDN17)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05160 Hepatitis C
    26285 (CLDN17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    26285 (CLDN17)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   26285 (CLDN17)
  Exosomal proteins of colorectal cancer cells
   26285 (CLDN17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 Clc-like Jiraiya Claudin_3
Motif
Other DBs
NCBI-GeneID: 26285
NCBI-ProteinID: NP_036263
OMIM: 617005
HGNC: 2038
Ensembl: ENSG00000156282
Vega: OTTHUMG00000081873
Pharos: P56750(Tdark)
UniProt: P56750
Position
21q21.3
AA seq 224 aa AA seqDB search
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARV
RLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLG
TSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGG
LLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtgggg
actcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacatt
attgtctttgagaggctctgggaagggctctggatgaattgcatccgacaagccagggtc
cggttgcaatgcaagttctatagctccttgttggctctcccgcctgccctggaaacagcc
cgggccctcatgtgtgtggctgttgctctctccttgatcgccctgcttattggcatctgt
ggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctggga
acttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggaca
gccaatataatcatcagagatttctacaacccagccatccacataggtcagaaacgagag
ctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggt
ctgctttgtggattttgctgctgcaacagaaagaagcaagggtacagatatccagtgcct
ggctaccgtgtgccacacacagataagcgaagaaatacgacaatgcttagtaagacctcc
accagttatgtctaa

DBGET integrated database retrieval system