KEGG   Homo sapiens (human): 26286Help
Entry
26286             CDS       T01001                                 

Gene name
ARFGAP3, ARFGAP1
Definition
(RefSeq) ADP ribosylation factor GTPase activating protein 3
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    26286 (ARFGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26286 (ARFGAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    26286 (ARFGAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap TMF_DNA_bd
Motif
Other DBs
NCBI-GeneID: 26286
NCBI-ProteinID: NP_055385
OMIM: 612439
HGNC: 661
Ensembl: ENSG00000242247
Vega: OTTHUMG00000150718
Pharos: Q9NP61(Tbio)
UniProt: Q9NP61 A0A024R4U0
Structure
PDB: 

Position
22q13.2
AA seq 516 aa AA seqDB search
MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSL
ASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPV
ETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANT
CFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNV
DSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEP
VELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLP
NAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccccagcaagcaggacatcttgaccatcttcaagcgcctccgctcggtgccc
actaacaaggtgtgttttgattgtggtgccaaaaatcccagctgggcaagcataacctat
ggagtgttcctttgcattgattgctcagggtcccaccggtcacttggtgttcacttgagt
tttattcgatctacagagttggattccaactggtcatggtttcagttgcgatgcatgcaa
gtcggaggaaacgctagtgcatcttccttttttcatcaacatgggtgttccaccaatgac
accaatgccaagtacaacagtcgtgctgctcagctctatagggagaaaatcaaatcgctc
gcctctcaagcaacacggaagcatggcactgatctgtggcttgatagttgtgtggttcca
cctttgtcccctccaccaaaggaggaagatttttttgcctctcacgtttctcctgaggtg
agtgacacagcgtgggcatcagcaatagcagaaccatcttctttaacatcaaggcctgtg
gaaaccactttggaaaataatgaaggtggacaagagcaaggaccaagtgtggaaggtctt
aatgtaccaacaaaggctactttagaggtatcctctatcataaaaaagaaaccaaatcaa
gctaaaaaaggccttggggccaaaaaaggaagtttgggagctcagaaactggcaaacaca
tgctttaatgaaattgaaaaacaagctcaagctgcggataaaatgaaggagcaggaagac
ctggccaaggtggtatctaaagaagaatcaattgtttcatcattacgattagcctataag
gatcttgaaattcaaatgaagaaagacgaaaagatgaacattagtggcaaaaaaaatgtt
gactcagacagactcggcatgggatttggaaattgcagaagtgttatttcacattcagtg
acttcagatatgcagaccatagagcaggaatcacccattatggcaaaaccaagaaaaaag
tataatgatgacagtgacgattcatattttacttccagctcaagttactttgacgagcca
gtggagttaaggagcagttctttctctagctgggatgacagttcagattcctattggaaa
aaagagaccagcaaagatactgaaacagttctgaaaaccacaggctattcagacagacct
actgctcgccgcaagccagattatgagccagttgaaaatacagatgaggcccagaagaag
tttggcaatgtcaaggccatttcatcagatatgtattttggaagacaatcccaggctgat
tatgagaccagggcccgcctagagaggctgtcggcaagttcctccataagctcggctgat
ctgttcgaggagccgaggaagcagccagcagggaactacagcctgtccagtgtgctgccc
aacgcccccgacatggcgcagttcaagcagggagtgagatcggttgctggaaaactctcc
gtctttgctaatggagtcgtgacttcaattcaggatcgctacggttcttaa

DBGET integrated database retrieval system