KEGG   Homo sapiens (human): 26287
Entry
26287             CDS       T01001                                 
Symbol
ANKRD2, ARPP
Name
(RefSeq) ankyrin repeat domain 2
  KO
K21434  ankyrin repeat domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26287 (ANKRD2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    26287 (ANKRD2)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 26287
NCBI-ProteinID: NP_065082
OMIM: 610734
HGNC: 495
Ensembl: ENSG00000165887
Pharos: Q9GZV1(Tbio)
UniProt: Q9GZV1
Position
10:97572441..97583884
AA seq 360 aa
MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRG
DARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRK
KRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQF
RRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADT
NVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLL
LHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcaaaggcgcccagctgggcaggggtgggtgctctggcctataaagcccccgaggcc
ctgtggcctgcagaggcggttatggacggcaccatggaggactccgaggcggtgcagagg
gccacagcgctcatcgagcagcggctggcacaggaggaggagaatgagaaactccgagga
gacgcacgccagaagctgcccatggacttgctggtgctggaggatgagaagcaccacggg
gctcagagtgcagccctgcagaaggtgaagggccaagagcgcgtgcgcaagacgtccctg
gacctgcggcgggagatcatcgatgtgggcgggatccagaacctcatcgagctgcggaag
aaacgcaagcagaagaagcgggacgctctggccgcctcgcatgagccgcccccagagccc
gaggagatcactggccctgtggatgaggagaccttcctgaaagctgcggtggaggggaaa
atgaaggtcattgagaagttcctggctgacggggggtcagccgacacgtgcgaccagttc
cgtcggacagcactgcaccgagcttccctggaaggccacatggaaatcctggagaagctt
ctagataatggggccactgtggacttccaggatcggctggactgcacagccatgcattgg
gcctgccgcgggggccacttagaggtggtgaaacttctgcaaagccatggagcagacacc
aatgtgagggataagctgctgagcaccccgctgcacgtggcagtccggacagggcaggtg
gagattgtggagcactttctatccctgggcctggaaatcaatgccagagacagggaaggg
gatactgccctgcatgacgctgtgaggctcaaccgctacaaaatcatcaaactgctgctc
ctgcatggggctgacatgatgaccaagaacctggcaggaaagaccccgacggacctggtg
cagctctggcaggctgatacccggcacgccctggagcatcctgagccgggggctgagcat
aacgggctggaggggcctaatgatagtgggcgagagacccctcagcctgtgccagcccag
tga

DBGET integrated database retrieval system