KEGG   Homo sapiens (human): 26289Help
Entry
26289             CDS       T01001                                 

Gene name
AK5, AK6
Definition
(RefSeq) adenylate kinase 5
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00730  Thiamine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    26289 (AK5)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    26289 (AK5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    26289 (AK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     26289 (AK5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   26289 (AK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Cytidylate_kin Zeta_toxin AAA_28 Thymidylate_kin Hydin_ADK AAA_22 dNK AAA_19 Ploopntkinase3 Dpy-30
Motif
Other DBs
NCBI-GeneID: 26289
NCBI-ProteinID: NP_777283
OMIM: 608009
HGNC: 365
Ensembl: ENSG00000154027
Vega: OTTHUMG00000009796
Pharos: Q9Y6K8(Tbio)
UniProt: Q9Y6K8
Structure
PDB: 

Position
1p31.1
AA seq 562 aa AA seqDB search
MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKW
SLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDA
DRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNV
FGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDP
QLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHK
INAEGTPEDVFLQLCTAIDSIF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaacgatgccaaggagtatctggcccggagggaaatccctcagctttttgag
agccttttgaatggactgatgtgttctaagcccgaagatccagtagaatacttggaaagt
tgtttacaaaaagtaaaggaactgggtggctgtgacaaggtgaaatgggatacatttgta
agccaggaaaagaagaccttacctccactaaatggaggacagtcacggagatcctttcta
agaaatgtaatgcctgaaaactcaaactttccatatcggcggtatgaccggctccctcca
atccatcaattctccatagaaagtgacacggatctctctgagactgcagagttgattgag
gagtatgaggtttttgatcctaccagacctcgaccaaaaatcattcttgttataggtggt
ccaggaagtggaaagggtactcagagtttgaaaattgcagaacgatatggattccaatac
atttctgtgggagaattattaagaaagaagatccacagtaccagcagcaataggaaatgg
agtcttattgccaagataattacaactggagaattggccccacaggaaacaacaattaca
gagataaaacaaaaattgatgcaaatacctgatgaagagggcattgttattgatggattt
ccaagagatgttgcccaggctctatcttttgaggaccaaatctgtacccccgatttggtg
gtattcctggcttgtgctaatcagagactcaaagaaagattactgaagcgtgcagaacag
cagggccgaccagacgacaatgtaaaagctacccaaaggagactaatgaacttcaagcag
aatgctgctccattggttaaatacttccaggaaaaggggctcatcatgacatttgatgcc
gaccgcgatgaggatgaggtgttctatgacatcagcatggcagttgacaacaagttattt
ccaaacaaagaggctgcagcaggttcaagtgaccttgatccttcgatgatattggacact
ggagagatcattgatacaggatctgattatgaagatcagggtgatgaccagttaaatgta
tttggagaggacactatgggaggtttcatggaagatttgagaaagtgtaaaattattttc
ataattggtggtcctggctctggcaaaggcacacagtgtgaaaagctggtggaaaaatat
ggatttacacatctctcaactggcgagctcctgcgtgaggaactggcatcagaatctgaa
agaagcaaattgatcagagacattatggaacgtggagacctggtgccctcaggcatcgtt
ttggagctcctgaaggaggccatggtggccagcctcggggacaccaggggcttcctgatt
gacggctatcctcgggaggtgaagcaaggggaagagttcggacgcaggattggagaccca
cagttggtgatctgtatggactgctcggcagacaccatgaccaaccgccttctccaaagg
agccggagcagcctgcctgtggacgacaccaccaagaccatcgccaagcgcctagaagcc
tactaccgagcgtccatccccgtgatcgcctactacgagacaaaaacacagctacacaag
ataaatgcagagggaacaccagaggacgtttttcttcaactctgcacagctattgactct
attttctga

DBGET integrated database retrieval system