KEGG   Homo sapiens (human): 26292Help
Entry
26292             CDS       T01001                                 

Gene name
MYCBP, AMY-1
Definition
(RefSeq) MYC binding protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TSC22 ZapB YabA
Motif
Other DBs
NCBI-GeneID: 26292
NCBI-ProteinID: NP_036465
OMIM: 606535
HGNC: 7554
Ensembl: ENSG00000214114
Vega: OTTHUMG00000000484
Pharos: Q99417(Tbio)
UniProt: Q99417
Structure
PDB: 

Position
1p34.3
AA seq 103 aa AA seqDB search
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcccattacaaagccgccgactcgaagcgtgagcagttccggaggtacttggagaag
tcgggggtgctggacacgctgaccaaggtgttggtagccttatatgaagaaccagagaaa
cctaacagtgctttggattttttaaagcatcacttaggagctgctactccagaaaatcca
gaaatagagctgcttcgcctagaactggccgaaatgaaagagaagtatgaagctattgta
gaagaaaataaaaaactgaaagcaaagcttgctcagtatgaaccacctcaggaggagaag
cgtgctgaatag

DBGET integrated database retrieval system