KEGG   Homo sapiens (human): 2633Help
Entry
2633              CDS       T01001                                 

Gene name
GBP1
Definition
(RefSeq) guanylate binding protein 1
  KO
K20899  guanylate-binding protein 1/3/4/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    2633 (GBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GBP_C GBP MMR_HSR1 FlgT_C
Motif
Other DBs
NCBI-GeneID: 2633
NCBI-ProteinID: NP_002044
OMIM: 600411
HGNC: 4182
Ensembl: ENSG00000117228
Vega: OTTHUMG00000010614
Pharos: P32455(Tbio)
UniProt: P32455
Structure
PDB: 

Position
1p22.2
AA seq 592 aa AA seqDB search
MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAG
KKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV
LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVW
TLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR
PVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY
VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETLQELLDLHRDS
EREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE
EVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ
TLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRV
QLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagagatccacatgacaggcccaatgtgcctcattgagaacactaatgggcga
ctgatggcgaatccagaagctctgaagatcctttctgccattacacagcctatggtggtg
gtggcaattgtgggcctctaccgcacaggcaaatcctacctgatgaacaagctggctgga
aagaaaaagggcttctctctgggctccacggtgcagtctcacactaaaggaatctggatg
tggtgtgtgccccaccccaagaagccaggccacatcctagttctgctggacaccgagggt
ctgggagatgtagagaagggtgacaaccagaatgactcctggatcttcgccctggccgtc
ctcctgagcagcaccttcgtgtacaatagcataggaaccatcaaccagcaggctatggac
caactgtactatgtgacagagctgacacatagaatccgatcaaaatcctcacctgatgag
aatgagaatgaggttgaggattcagctgactttgtgagcttcttcccagactttgtgtgg
acactgagagatttctccctggacttggaagcagatggacaacccctcacaccagatgag
tacctgacatactccctgaagctgaagaaaggtaccagtcaaaaagatgaaacttttaac
ctgcccagactctgtatccggaaattcttcccaaagaaaaaatgctttgtctttgatcgg
cccgttcaccgcaggaagcttgcccagctcgagaaactacaagatgaagagctggacccc
gaatttgtgcaacaagtagcagacttctgttcctacatctttagtaattccaaaactaaa
actctttcaggaggcatccaggtcaacgggcctcgtctagagagcctggtgctgacctac
gtcaatgccatcagcagtggggatctgccgtgcatggagaacgcagtcctggccttggcc
cagatagagaactcagctgcagtgcaaaaggctattgcccactatgaacagcagatgggc
cagaaggtgcagctgcccacagaaaccctccaggagctgctggacctgcacagggacagt
gagagagaggccattgaagtcttcatcaggagttccttcaaagatgtggaccatctattt
caaaaggagttagcggcccagctagaaaaaaagcgggatgacttttgtaaacagaatcag
gaagcatcatcagatcgttgctcagctttacttcaggtcattttcagtcctctagaagaa
gaagtgaaggcgggaatttattcgaaaccagggggctatcgtctctttgttcagaagcta
caagacctgaagaaaaagtactatgaggaaccgaggaaggggatacaggctgaagagatt
ctgcagacatacttgaaatccaaggagtctatgactgatgcaattctccagacagaccag
actctcacagaaaaagaaaaggagattgaagtggaacgtgtgaaagctgagtctgcacag
gcttcagcaaaaatgttgcaggaaatgcaaagaaagaatgagcagatgatggaacagaag
gagaggagttatcaggaacacttgaaacaactgactgagaagatggagaacgacagggtc
cagttgctgaaagagcaagagaggaccctcgctcttaaacttcaggaacaggagcaacta
ctaaaagagggatttcaaaaagaaagcagaataatgaaaaatgagatacaggatctccag
acgaaaatgagacgacgaaaggcatgtaccataagctaa

DBGET integrated database retrieval system