KEGG   Homo sapiens (human): 26333Help
Entry
26333             CDS       T01001                                 

Gene name
OR7A17, BC85395_4, HTPCRX19
Definition
(RefSeq) olfactory receptor family 7 subfamily A member 17
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26333 (OR7A17)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26333 (OR7A17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26333
NCBI-ProteinID: NP_112163
HGNC: 8363
Ensembl: ENSG00000185385
Vega: OTTHUMG00000183415
Pharos: O14581(Tdark)
UniProt: O14581 A0A126GVR5
Position
19p13.12
AA seq 309 aa AA seqDB search
MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAY
DRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCE
LNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFST
CASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRA
LKMSFRGKQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagagaatgacacagggatttcagaatttgttcttctgggactttctgaggaa
ccagaattgcagcccttcctctttgggctgtttctgtccatgtacctggtcactgtgctc
gggaatctgctcatcatcctggccacaatctcagactcccacctccacacccccatgtac
ttcttcctctccaacctgtcctttgcagacatctgtttcatctccactacaatcccaaag
atgctcattaacatccagacacagagcagagtcatcacctatgcaggctgcatcacccag
atgtgcttttttgtactttttggagggttagacagcttactcctggctgtgatggcctat
gatcggtttgtggccatctgtcatcctctgcactacacagtcatcatgaaccctcggctc
tgtggactcctggttctggcatcctggatgattgctgccctgaattccttgtcacaaagc
ttaatggtattgtggctgtccttctgcacagacttggaaatcccccactttttctgtgaa
cttaatcaggtcatccaccttgcctgttctgacacctttcttaatgacatggggatgtat
tttgcagcagggctgctggctggtggtccccttgtggggatcctttgctcttactctaag
atagtttcctccatacgtgcaatctcatcagctcaggggaagtacaaggcattttccacc
tgtgcatcacacctctcagttgtctctttattttgttgtacgggcctaggtgtgtacctt
acttctgctgcaacccacaactcacacacaagtgcaacagcctcagtgatgtacactgtg
gccacccccatgctgaacccctttatctacagtctgaggaataaagacataaagagggct
ctgaaaatgtccttcagaggaaagcaataa

DBGET integrated database retrieval system