KEGG   Homo sapiens (human): 2634
Entry
2634              CDS       T01001                                 

Gene name
GBP2
Definition
(RefSeq) guanylate binding protein 2
  KO
K20897  guanylate-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2634 (GBP2)
SSDB
Motif
Pfam: GBP_C GBP RHD3 MMR_HSR1 zf-NPL4
Other DBs
NCBI-GeneID: 2634
NCBI-ProteinID: NP_004111
OMIM: 600412
HGNC: 4183
Ensembl: ENSG00000162645
Vega: OTTHUMG00000010662
Pharos: P32456(Tbio)
UniProt: P32456 Q8TCE5
Position
1p22.2
AA seq 591 aa
MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAI
LLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTL
RDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPA
PKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVN
AISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQELLDLHRDSER
EAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV
KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSL
SEKEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQL
MAEQEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggctccagagatcaacttgccgggcccaatgagcctcattgataacactaaagggcag
ctggtggtgaatccagaagctctgaagatcctatctgcaattacgcagcctgtggtggtg
gtggcgattgtgggcctctatcgcacaggcaaatcctacctgatgaacaagctggctggg
aagaaaaacggcttctctctaggctccacagtgaagtctcacaccaagggaatctggatg
tggtgtgtgcctcatcccaagaagccagaacacaccctagttctgctcgacactgagggc
ctgggagatatagagaagggtgacaatgagaatgactcctggatctttgccttggccatc
ctcctgagcagcaccttcgtgtacaatagcatgggaaccatcaaccagcaggccatggac
caacttcactatgtgacagagctgacagatcgaatcaaggcaaactcctcacctggtaac
aattctgtagacgactcagctgactttgtgagcttttttccagcatttgtgtggactctc
agagatttcaccctggaactggaagtagatggagaacccatcactgctgatgactacttg
gagctttcgctaaagctaagaaaaggtactgataagaaaagtaaaagctttaatgatcct
cggttgtgcatccgaaagttcttccccaagaggaagtgcttcgtcttcgattggcccgct
cctaagaagtaccttgctcacctagagcagctaaaggaggaagagctgaaccctgatttc
atagaacaagttgcagaattttgttcctacatcctcagccattccaatgtcaagactctt
tcaggtggcattccagtcaatgggcctcgtctagagagcctggtgctgacctacgtcaat
gccatcagcagtggggatctaccctgcatggagaacgcagtcctggccttggcccagata
gagaactcagccgcagtggaaaaggctattgcccactatgaacagcagatgggccagaag
gtgcagctgcccacggaaaccctccaggagctgctggacctgcacagggacagtgagaga
gaggccattgaagtcttcatgaagaactctttcaaggatgtggaccaaatgttccagagg
aaattaggggcccagttggaagcaaggcgagatgacttttgtaagcagaattccaaagca
tcatcagattgttgcatggctttacttcaggatatatttggccctttagaagaagatgtc
aagcagggaacattttctaaaccaggaggttaccgtctctttactcagaagctgcaggag
ctgaagaataagtactaccaggtgccaaggaaggggatacaggccaaagaggtgctgaaa
aaatatttggagtccaaggaggatgtggctgatgcacttctacagactgatcagtcactc
tcagaaaaggaaaaagcgattgaagtggaacgtataaaggctgaatctgcagaagctgca
aagaaaatgttggaggaaatacaaaagaagaatgaggagatgatggaacagaaagagaag
agttatcaggaacatgtgaaacaattgactgagaagatggagagggacagggcccagtta
atggcagagcaagagaagaccctcgctcttaaacttcaggaacaggaacgccttctcaag
gagggattcgagaatgagagcaagagacttcaaaaagacatatgggatatccagatgaga
agcaaatcattggagccaatatgtaacatactctaa

DBGET integrated database retrieval system