KEGG   Homo sapiens (human): 2638
Entry
2638              CDS       T01001                                 
Symbol
GC, DBP, DBP-maf, DBP/GC, GRD3, Gc-MAF, GcMAF, HEL-S-51, VDB, VDBG, VDBP
Name
(RefSeq) GC vitamin D binding protein
  KO
K12258  vitamin D-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    2638 (GC)
SSDB
Motif
Pfam: Serum_albumin VitD-bind_III Borrelia_REV
Other DBs
NCBI-GeneID: 2638
NCBI-ProteinID: NP_000574
OMIM: 139200
HGNC: 4187
Ensembl: ENSG00000145321
Pharos: P02774(Tchem)
UniProt: P02774
Structure
Position
4:complement(71741693..71805520)
AA seq 474 aa
MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQV
SQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERK
LCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTK
SYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLA
QKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCC
QEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVF
LSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKK
KLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaagagggtcctggtactactgcttgctgtggcatttggacatgctttagagagaggc
cgggattatgaaaagaataaagtctgcaaggaattctcccatctgggaaaggaggacttc
acatctctgtcactagtcctgtacagtagaaaatttcccagtggcacgtttgaacaggtc
agccaacttgtgaaggaagttgtctccttgaccgaagcctgctgtgcggaaggggctgac
cctgactgctatgacaccaggacctcagcactgtctgccaagtcctgtgaaagtaattct
ccattccccgttcacccaggcactgctgagtgctgcaccaaagagggcctggaacgaaag
ctctgcatggctgctctgaaacaccagccacaggaattccctacctacgtggaacccaca
aatgatgaaatctgtgaggcgttcaggaaagatccaaaggaatatgctaatcaatttatg
tgggaatattccactaattacggacaagctcctctgtcacttttagtcagttacaccaag
agttatctttctatggtagggtcctgctgtacctctgcaagcccaactgtatgctttttg
aaagagagactccagcttaaacatttatcacttctcaccactctgtcaaatagagtctgc
tcacaatatgctgcttatggggagaagaaatcaaggctcagcaatctcataaagttagcc
caaaaagtgcctactgctgatctggaggatgttttgccactagctgaagatattactaac
atcctctccaaatgctgtgagtctgcctctgaagattgcatggccaaagagctgcctgaa
cacacagtaaaactctgtgacaatttatccacaaagaattctaagtttgaagactgttgt
caagaaaaaacagccatggacgtttttgtgtgcacttacttcatgccagctgcccaactc
cccgagcttccagatgtagagttgcccacaaacaaagatgtgtgtgatccaggaaacacc
aaagtcatggataagtatacatttgaactaagcagaaggactcatcttccggaagtattc
ctcagtaaggtacttgagccaaccctaaaaagccttggtgaatgctgtgatgttgaagac
tcaactacctgttttaatgctaagggccctctactaaagaaggaactatcttctttcatt
gacaagggacaagaactatgtgcagattattcagaaaatacatttactgagtacaagaaa
aaactggcagagcgactaaaagcaaaattgcctgatgccacacccacggaactggcaaag
ctggttaacaagcactcagactttgcctccaactgctgttccataaactcacctcctctt
tactgtgattcagagattgatgctgaattgaagaatatcctgtag

DBGET integrated database retrieval system