KEGG   Homo sapiens (human): 2639Help
Entry
2639              CDS       T01001                                 

Gene name
GCDH, ACAD5, GCD
Definition
(RefSeq) glutaryl-CoA dehydrogenase
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00310  Lysine degradation
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
Module
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Disease
H00178  Glutaric acidemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    2639 (GCDH)
  09105 Amino acid metabolism
   00310 Lysine degradation
    2639 (GCDH)
   00380 Tryptophan metabolism
    2639 (GCDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     2639 (GCDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 2639
NCBI-ProteinID: NP_000150
OMIM: 608801
HGNC: 4189
Ensembl: ENSG00000105607
Vega: OTTHUMG00000180561
Pharos: Q92947(Tbio)
UniProt: Q92947 A0A024R7F9
Structure
PDB: 

Position
19p13.13
AA seq 438 aa AA seqDB search
MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQL
TTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSS
VAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLT
EPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEK
GMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWG
VLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQD
KAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIH
ALILGRAITGIQAFTASK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagaggcgtctccgtgcggctgctgagccgcggacccggcctgcacgtcctt
cgcacgtgggtctcgtcggcggcgcagaccgagaaaggcgggagaacacagagccaactg
gctaagtcctcgcgtcccgagtttgactggcaggacccgctggtgctggaggagcagctg
accacagatgagatcctcatcagggacaccttccgcacctactgccaggagagactcatg
cctcgcatcctgttggccaatcgcaacgaagtttttcatcgggagatcatttcggagatg
ggggagttgggtgtgctgggccccaccatcaaaggatatggctgtgctggggtttcgtct
gtggcctatgggctcctggcccgagagctggagcgggtggacagtggctacaggtcggcg
atgagtgtccagtcctccctcgtcatgcaccctatctatgcctatggcagcgaggaacag
cggcagaagtacctgccccagctggccaagggggagctcctgggctgcttcgggctcaca
gagcccaacagcggaagtgaccccagcagcatggagaccagagcccactacaactcatcc
aacaagagctacaccctcaatgggaccaagacctggatcacgaactcgcctatggccgat
ctgtttgtagtgtgggctcggtgtgaagatggctgcattcggggcttcctgctggagaag
gggatgcggggtctctcggcccccaggatccagggcaagttctcgctgcgggcctcagcc
acaggcatgatcatcatggacggtgtggaggtgccagaggagaatgtgctccctggtgca
tccagcctggggggtcccttcggctgcctgaacaacgcccggtacggcatcgcgtggggc
gtgcttggagcttcggagttctgcttgcacacagcccggcagtacgccctcgacaggatg
cagtttggtgtcccactggccaggaaccagctgattcagaagaagctggcagacatgctc
actgagattaccctgggccttcacgcctgcctgcagctcggccgcttgaaggaccaggac
aaggctgcccccgagatggtttctctgctgaagaggaataactgtgggaaagccctggac
atcgcccgccaggcccgagacatgctgggggggaatgggatttctgacgagtatcacgtg
atccggcacgccatgaacctggaggccgtgaacacctacgaaggtacacatgacattcac
gccctgatccttgggagagctatcacgggaatccaggcgttcacggccagcaagtga

DBGET integrated database retrieval system