KEGG   Homo sapiens (human): 26469Help
Entry
26469             CDS       T01001                                 

Gene name
PTPN18, BDP1, PTP-HSCF
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 18
  KO
K18024  tyrosine-protein phosphatase non-receptor type 12/18/22 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    26469 (PTPN18)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     26469 (PTPN18)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    26469 (PTPN18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Y_phosphatase3 DUF2828 DSPc
Motif
Other DBs
NCBI-GeneID: 26469
NCBI-ProteinID: NP_055184
OMIM: 606587
HGNC: 9649
Ensembl: ENSG00000072135
Vega: OTTHUMG00000131630
Pharos: Q99952(Tdark)
UniProt: Q99952
Structure
PDB: 

Position
2q21.1
AA seq 460 aa AA seqDB search
MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKN
RYKDVLPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKR
GAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP
AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcagcctggactcggcgcggagcttcctggagcggctggaagcgcggggcggc
cgggagggggcagtcctcgccggcgagttcagcgacatccaggcctgctcggccgcctgg
aaggctgacggcgtgtgctccaccgtggccggcagtcggccagagaacgtgaggaagaac
cgctacaaagacgtgctgccttatgatcagacgcgagtaatcctctccctgctccaggaa
gagggacacagcgactacattaatggcaacttcatccggggcgtggatggaagcctggcc
tacattgccacgcaaggacccttgcctcacaccctgctagacttctggagactggtctgg
gagtttggggtcaaggtgatcctgatggcctgtcgagagatagagaatgggcggaaaagg
tgtgagcggtactgggcccaggagcaggagccactgcagactgggcttttctgcatcact
ctgataaaggagaagtggctgaatgaggacatcatgctcaggaccctcaaggtcacattc
cagaaggagtcccgttctgtgtaccagctacagtatatgtcctggccagaccgtggggtc
cccagcagtcctgaccacatgctcgccatggtggaggaagcccgtcgcctccagggatct
ggccctgaacccctctgtgtccactgcagtgcgggttgtgggcgaacaggcgtcctgtgc
accgtggattatgtgaggcagctgctcctgacccagatgatcccacctgacttcagtctc
tttgatgtggtccttaagatgaggaagcagcggcctgcggccgtgcagacagaggagcag
tacaggttcctgtaccacacggtggctcagatgttctgctccacactccagaatgccagc
ccccactaccagaacatcaaagagaattgtgccccactctacgacgatgccctcttcctc
cggactccccaggcacttctcgccataccccgcccaccaggaggggtcctcaggagcatc
tctgtgcccgggtccccgggccacgccatggctgacacctacgcggtggtgcagaagcgc
ggggctccagcgggcgccgggagtgggacgcagacggggacggggacggggacgggggcg
cgcagcgcggaggaggcgccgctctacagcaaggtgacgccgcgcgcccagcgacccggg
gcgcacgcggaggacgcgagggggacgctgcctggccgcgttcctgctgaccaaagtcct
gccggatctggcgcctacgaggacgtggcgggtggagctcagaccggtgggctaggtttc
aacctgcgcattgggaggccgaagggtccccgggacccgcctgctgagtggacccgggtg
taa

DBGET integrated database retrieval system