KEGG   Homo sapiens (human): 26470
Entry
26470             CDS       T01001                                 

Gene name
SEZ6L2, BSRPA, PSK-1
Definition
(RefSeq) seizure related 6 homolog like 2
  KO
K24363   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Sushi CUB
Other DBs
NCBI-GeneID: 26470
NCBI-ProteinID: NP_963869
OMIM: 616667
HGNC: 30844
Ensembl: ENSG00000174938
Vega: OTTHUMG00000132112
Pharos: Q6UXD5(Tbio)
UniProt: Q6UXD5
Position
16p11.2
AA seq 910 aa
MGTPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEILPEPGSETPTVASEALAELLHGALL
RRGPEMGYLPGSDRDPTLATPPAGQTLAVPSLPRATEPGTGPLTTAVTPNGVRGAGPTAP
ELLTPPPGTTAPPPPSPASPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGYVESPDLGSPVSRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPSWNGETPSCMASCGGTIHNATLGR
IVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGVHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL
EGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEA
GDTREYEVSI
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggggactcccagggcccagcacccgccgcctccccagctgctgttcctaattctgctg
agctgtccctggatccagggtctgcccctgaaggaggaggagatattgccagagcctgga
agtgagacccccacggtggcctctgaggccctggctgaactgcttcatggggccctgctg
aggaggggcccagagatgggctacctgccaggatctgatcgggaccccacgctagccacc
cctccggccggccagactctcgcagtgccctccctgccacgggccactgagccggggaca
gggcctctgacaacagccgtcacccctaacggggtcaggggggcaggccccactgcgcca
gaactgctgaccccgcccccaggaaccacagccccacccccacccagccctgcctcccca
gggcctccccttgggcctgagggaggagaggaggagacgacgaccaccatcatcaccacg
acaactgttaccactacggtgaccagcccagttctgtgtaataacaacatctccgagggc
gaagggtatgtggagtctccagatctggggagccccgtcagccgcaccctggggctcctg
gactgcacttacagcatccatgtctaccctggctacggcattgagatccaggtgcagacg
ctgaacctgtcacaggaagaggagctcctggtgctggctggtgggggatccccaggcctg
gccccccgactcctggccaactcatccatgcttggagaaggacaagtccttcggagccca
accaaccggctgcttctgcacttccagagcccacgggtcccaaggggcggtggcttcagg
atccactatcaggcctacctcctgagctgtggcttccctccccggccggcccatggggac
gtgagtgtgacggacctgcaccctgggggcactgccacctttcactgtgattcgggctac
cagctgcagggagaggagaccctcatctgcctcaatggcacccggccatcctggaacggt
gaaacccccagctgcatggcatcctgtggtggcaccatccacaatgccaccctgggccgc
atcgtgtccccagagcctgggggagccgtagggcccaacctcacctgccgttgggtcatt
gaagcagctgaggggcgccggctgcacctgcactttgaaagggtctcgctggatgaggac
aatgaccggctgatggtgcgctcagggggcagccccctatcccccgtgatctatgattcg
gacatggacgatgtccccgagcggggtctcatcagtgacgcccagtccctctacgtggag
ctgctgtcagagacacctgccaatcccctgctgttaagccttcgatttgaagcctttgag
gaggatcgctgcttcgcccccttcctggcacatggaaatgtcactaccacggaccctgag
tatcgcccaggggcactggcaaccttctcgtgcctcccaggatatgccctggagccccct
gggccccccaatgccatcgaatgtgtggatcccacagaaccccactggaacgacacagag
ccggcctgcaaagccatgtgtggaggggagctgtcggaaccagctggcgtggtcctctct
cccgactggccccagagctatagcccgggccaagactgcgtgtggggcgtgcacgtccag
gaagagaagcgcatcttgctccaagttgagatattgaatgtgcgggaaggggacatgctg
acgctgttcgacggggacggtcccagcgcccgagtcttggcccagctgcggggacctcag
ccgcgccgccgccttctctcctctgggcccgacctcacactgcagtttcaggcaccgccc
gggcccccaaatccaggcctgggccagggcttcgtattgcacttcaaagaggtcccgagg
aacgacacgtgccccgagctgccacctccggagtggggctggagaacggcatcccacggg
gacctgatccggggcacggtgctcacctaccagtgcgagcctggctacgagctgctaggc
tccgacattctcacttgccagtgggacctgtcttggagcgccgcgccgcccgcctgccaa
aagatcatgacttgtgctgaccctggcgagattgccaacgggcaccgcaccgcctcggac
gccggcttccccgttggctcccacgtccagtaccgctgcctgccagggtacagcctcgag
ggggcagccatgctcacctgctacagccgggacacaggcacacccaagtggagcgatagg
gtccccaaatgcgccttgaagtacgagccgtgcctgaacccgggggttcccgagaatggc
taccagacgctgtacaagcaccactaccaggcgggcgagtctctgcgcttcttctgctat
gagggctttgagcttatcggcgaggtcaccatcacctgtgtgcccggccacccctcccag
tggaccagccagcccccactctgcaaagtgacccagaccacagatccatcacggcagctg
gaaggggggaacctggccctggccatcctgctgcctctaggcttggtcattgtcctcggc
agtggcgtttacatctactacaccaagcttcagggaaagtcccttttcggcttctcgggc
tcccactcctacagccccatcaccgtggagtcggacttcagcaacccgctgtatgaagct
ggggatacgcgggagtatgaagtttccatctga

DBGET integrated database retrieval system