KEGG   Homo sapiens (human): 26476Help
Entry
26476             CDS       T01001                                 

Gene name
OR10J1, HGMP07J, HSHGMP07J
Definition
(RefSeq) olfactory receptor family 10 subfamily J member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26476 (OR10J1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26476 (OR10J1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Spo7
Motif
Other DBs
NCBI-GeneID: 26476
NCBI-ProteinID: NP_036483
HGNC: 8175
Ensembl: ENSG00000196184
Vega: OTTHUMG00000022737
Pharos: P30954(Tdark)
UniProt: P30954
Position
1q23.2
AA seq 320 aa AA seqDB search
MLLCFRFGNQSMKRENFTLITDFVFQGFSSFHEQQITLFGVFLALYILTLAGNIIIVTII
RMDLHLHTPMYFFLSMLSTSETVYTLVILPRMLSSLVGMSQPISLAGCATQMFFFVTFGI
TNCFLLTAMGYDRYVAICNPLRYMVIMNKRLRIQLVLGACSIGLIVAITQVTSVFRLPFC
ARKVPHFFCDIRPVMKLSCIDTTVNEILTLIISVLVLVVPMGLVFISYVLIISTILKIAS
VEGRKKAFATCASHLTVVIVHYSCASIAYLKPKSENTREHDQLISVTYTVITPLLNPVVY
TLRNKEVKDALCRAVGGKFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatgtttcagatttgggaaccaatccatgaaaagagagaactttactctcatc
actgactttgttttccaaggtttctctagcttccatgagcagcagatcaccctttttggc
gtgttccttgcactatacatcttaaccttagcaggcaatatcatcattgtgaccatcatc
cgaatggatcttcatcttcacacacccatgtacttcttcctgagcatgctgtccacttca
gagactgtatatacattggtcattctcccaagaatgctctccagcctcgtaggtatgagc
cagcccatatcattggcagggtgtgccacacagatgttcttttttgtaacctttggcatc
actaactgcttcctgctcacagcaatgggatatgaccgctatgtggccatctgcaacccc
ctgagatacatggttattatgaacaagaggctgcgtatccaacttgtcctgggggcctgc
agcattgggctgattgtagcaataacgcaagtgacatctgtattcaggttacccttctgt
gctagaaaggtgccccacttcttctgtgacatccgccctgtgatgaagctctcctgcatt
gacaccactgtcaatgaaatcctgactttgattatcagtgtgctggtgcttgttgtacct
atgggtctggttttcatttcttatgttctcattatctctacaatcctcaagattgcttca
gttgagggccggaagaaggcttttgccacctgtgcatcccacctcactgtggtcattgtc
cactacagctgtgcctccattgcctacctcaagcccaagtcagagaacaccagagaacat
gaccagctgatctcggtgacctacactgtcatcactcccctactgaaccctgtggtatac
accctgagaaataaagaggtcaaagatgctctgtgcagggctgttggtgggaagttttcc
tga

DBGET integrated database retrieval system