KEGG   Homo sapiens (human): 26494
Entry
26494             CDS       T01001                                 
Symbol
OR8G1, HSTPCR25, OR8G1P, TPCR25
Name
(RefSeq) olfactory receptor family 8 subfamily G member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    26494 (OR8G1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    26494 (OR8G1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    26494 (OR8G1)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 26494
NCBI-ProteinID: NP_001002905
HGNC: 8484
Ensembl: ENSG00000197849
Pharos: Q15617(Tdark)
UniProt: Q15617 A0A126GVX6
Position
11:124241095..124254364
AA seq 311 aa
MSGENNSSVTEFILAGLSEQPELQLPLFLLFLGIYVVTVVGNLGMTTLIWLSSHLHTPMY
YFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY
DRYMAICSPLLYSVIISNKACFSLILGVYIIGLVCASVHTGCMFRVQFCKFDLINHYFCD
LLPLLKLSCSSIYVNKLLILCVGAFNILVPSLTILCSYIFIIASILHIRSTEGRSKAFST
CSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTIIVPMLNPLIYSLRNKDVHVS
LKKMLQRRTLL
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtcaggagaaaataattcctcagtgactgagttcattctggctgggctctcagaacag
ccagagctccagctgcccctcttcctcctgttcttaggaatctatgtggtcacagtggtg
ggcaacctgggcatgaccacactgatttggctcagttctcacctgcacacccctatgtac
tatttcctcagcagtctgtccttcattgacttctgccattccactgtcattacccctaag
atgctggtgaactttgtgacagagaagaacatcatctcctaccctgaatgcatgactcag
ctctacttcttcctcgtttttgctattgcagagtgtcacatgttggctgcaatggcgtat
gaccgttacatggccatctgtagccccttgctgtacagtgtcatcatatccaataaggct
tgcttttctctgattttaggggtgtatataataggcctggtttgtgcatcagttcataca
ggctgtatgtttagggttcaattctgcaaatttgatttgattaaccattatttctgtgat
cttcttcccctcctaaagctctcttgctctagtatctatgtcaacaaactacttattcta
tgtgttggtgcatttaacatccttgtccccagcctgaccatcctttgctcttacatcttt
attattgccagcatcctccacattcgctccactgagggcaggtccaaagccttcagcact
tgtagctcccacatgttggcggttgtaatcttttttggatctgcagcattcatgtacttg
cagccatcttcaatcagctccatggaccaggggaaagtatcctctgtgttttatactatt
attgtgcccatgttgaaccctctgatttatagcctgaggaataaagatgtccatgtttcc
ctgaagaaaatgctacagagaagaacattattgtaa

DBGET integrated database retrieval system