KEGG   Homo sapiens (human): 2650Help
Entry
2650              CDS       T01001                                 

Gene name
GCNT1, C2GNT, C2GNT-L, C2GNT1, G6NT, NACGT2, NAGCT2
Definition
(RefSeq) glucosaminyl (N-acetyl) transferase 1, core 2
  KO
K00727  beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase [EC:2.4.1.102]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    2650 (GCNT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.102  beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
     2650 (GCNT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   2650 (GCNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Branch
Motif
Other DBs
NCBI-GeneID: 2650
NCBI-ProteinID: NP_001091102
OMIM: 600391
HGNC: 4203
Ensembl: ENSG00000187210
Vega: OTTHUMG00000020044
Pharos: Q02742(Tbio)
UniProt: Q02742 Q86T81
Position
9q21.13
AA seq 428 aa AA seqDB search
MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCT
KVLQGDVNEIQKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE
FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVAS
RLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN
NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL
QNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE
GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH
KALETLKH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacgttgctgcgaaggagacttttttcttatcccaccaaatactactttatg
gttcttgttttatccctaatcaccttctccgttttaaggattcatcaaaagcctgaattt
gtaagtgtcagacacttggagcttgctggggagaatcctagtagtgatattaattgcacc
aaagttttacagggtgatgtaaatgaaatccaaaaggtaaagcttgagatcctaacagtg
aaatttaaaaagcgccctcggtggacacctgacgactatataaacatgaccagtgactgt
tcttctttcatcaagagacgcaaatatattgtagaaccccttagtaaagaagaggcggag
tttccaatagcatattctatagtggttcatcacaagattgaaatgcttgacaggctgctg
agggccatctatatgcctcagaatttctattgcattcatgtggacacaaaatccgaggat
tcctatttagctgcagtgatgggcatcgcttcctgttttagtaatgtctttgtggccagc
cgattggagagtgtggtttatgcatcgtggagccgggttcaggctgacctcaactgcatg
aaggatctctatgcaatgagtgcaaactggaagtacttgataaatctttgtggtatggat
tttcccattaaaaccaacctagaaattgtcaggaagctcaagttgttaatgggagaaaac
aacctggaaacggagaggatgccatcccataaagaagaaaggtggaagaagcggtatgag
gtcgttaatggaaagctgacaaacacagggactgtcaaaatgcttcctccactcgaaaca
cctctcttttctggcagtgcctacttcgtggtcagtagggagtatgtggggtatgtacta
cagaatgaaaaaatccaaaagttgatggagtgggcacaagacacatacagccctgatgag
tatctctgggccaccatccaaaggattcctgaagtcccgggctcactccctgccagccat
aagtatgatctgtctgacatgcaagcagttgccaggtttgtcaagtggcagtactttgag
ggtgatgtttccaagggtgctccctacccgccctgcgatggagtccatgtgcgctcagtg
tgcattttcggagctggtgacttgaactggatgctgcgcaaacaccacttgtttgccaat
aagtttgacgtggatgttgacctctttgccatccagtgtttggatgagcatttgagacac
aaagctttggagacattaaaacactga

DBGET integrated database retrieval system