KEGG   Homo sapiens (human): 26504Help
Entry
26504             CDS       T01001                                 

Gene name
CNNM4, ACDP4
Definition
(RefSeq) cyclin and CBS domain divalent metal cation transport mediator 4
  KO
K16302  metal transporter CNNM
Organism
hsa  Homo sapiens (human)
Disease
H01015  Jalili syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    26504 (CNNM4)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   26504 (CNNM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF21 CBS cNMP_binding
Motif
Other DBs
NCBI-GeneID: 26504
NCBI-ProteinID: NP_064569
OMIM: 607805
HGNC: 105
Ensembl: ENSG00000158158
Vega: OTTHUMG00000130532
Pharos: Q6P4Q7(Tbio)
UniProt: Q6P4Q7
Structure
PDB: 

Position
2q11.2
AA seq 775 aa AA seqDB search
MAPVGGGGRPVGGPARGRLLLAAPVLLVLLWALGARGQGSPQQGTIVGMRLASCNKSCGT
NPDGIIFVSEGSTVNLRLYGYSLGNISSNLISFTEVDDAETLHKSTSCLELTKDLVVQQL
VNVSRGNTSGVLVVLTKFLRRSESMKLYALCTRAQPDGPWLKWTDKDSLLFMVEEPGRFL
PLWLHILLITVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERRYARKIEPIRRKGN
YLLCSLLLGNVLVNTSLTILLDNLIGSGLMAVASSTIGIVIFGEILPQALCSRHGLAVGA
NTILLTKFFMLLTFPLSFPISKLLDFFLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELN
MIQGALELRTKTVEDIMTQLQDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVD
ILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNN
EGEGDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADN
ELKVKISPQLLLAAHRFLATEVSQFSPSLISEKILLRLLKYPDVIQELKFDEHNKYYARH
YLYTRNKPADYFILILQGKVEVEAGKENMKFETGAFSYYGTMALTSVPSDRSPAHPTPLS
RSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGL
LASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKASHENAI
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgggcgggggcgggcgcccggtcggcggaccggcccgcgggcgcctcctc
ctggcggcgccggtgctgctggtgctgctgtgggcgctgggggcccggggccagggcagc
ccccagcagggcacgatcgtgggcatgaggctggcgagctgcaacaagtcgtgtgggacg
aacccggatggcatcatcttcgtgtccgagggcagcaccgtgaacctgaggctgtacggc
tacagcctgggcaacatctccagcaacctgatctccttcaccgaggtggacgatgccgag
accctccacaagtccaccagctgcctcgagctcaccaaggacctggtcgtccagcagctg
gtcaacgtgagccgcgggaacacgtccggcgtgctggtggtgctcaccaagttcctccgg
aggagcgagagcatgaagctgtatgcactgtgcacccgggcccagcccgacgggccctgg
ctgaagtggacggacaaggactcactgctcttcatggtggaggagcctgggaggttcctg
cctctctggctgcacattctcctaattacggtgctgctggtgctgtcgggcatattttct
ggcctcaacctcgggcttatggccctggaccccatggagctgcgcatcgtgcagaactgt
ggcaccgagaaggagaggcgctatgcccgcaagattgagcccatccggcgcaagggcaac
taccttctctgctcgttgctcctagggaacgtgctggtcaacacctccctcacaatcctt
ctagacaacctcatcgggtccggcctcatggcggtggcctcctccaccattggcattgtc
atctttggggagatcctacctcaggccctgtgctcccgacatgggctggctgtgggtgcc
aacaccatccttctcaccaaattctttatgctactcaccttccccctcagttttcccatt
agcaagctcctggacttttttctgggccaggagattcgcactgtttacaaccgggagaag
ctgatggagatgttgaaggtgacggagccctataatgacctcgtgaaagaggagctcaat
atgatccagggtgccctggaactacggaccaaaactgtagaggatatcatgacccagctc
caggactgcttcatgatccgcagcgatgccatcctggacttcaacaccatgtcggagata
atggaaagcggctatactcgcatcccggtgttcgaagacgagcagtccaatattgtagat
attctctacgtcaaagacttggcctttgtggaccccgatgactgcacccccctcaagact
atcactcgcttctataaccacccggtgcactttgtcttccatgacaccaagttggatgcc
atgctggaggagttcaagaaggggaagtcccacctggccatcgtgcagaaggtaaacaac
gagggtgagggtgaccccttctacgaggtcctgggcctggtcaccctggaggacgtgatc
gaggagatcatcaagtcggagatcctggacgagtccgacatgtacactgacaaccgaagc
cggaagcgggtgtctgagaagaacaagcgtgacttctctgccttcaaggatgcggacaat
gagctcaaagtgaaaatctccccgcagctcctcctggccgctcatcgcttcctagccaca
gaggtctctcagtttagcccctccctgatatcagagaagatcctgctgcggctactcaag
tacccagatgtcattcaggaactcaagtttgacgagcacaataagtactacgcccgccat
tacctgtacacccgaaataagccggccgactacttcatcctcatcctgcaggggaaggtg
gaggtggaggcagggaaggagaacatgaagtttgagacgggcgccttctcctactatggg
actatggccctgacctcggtcccctccgaccgttccccagcacaccccaccccactcagc
cgctcagcctccctcagttacccagaccgcacagacgtctcaactgcagcaaccttggca
ggcagcagcaaccagtttggcagctctgtcctgggccagtacatctctgacttcagcgtc
cgggcactcgtggacttgcagtacatcaagatcactcggcagcagtaccagaacgggctg
ctggcttctcgcatggagaacagccctcagtttcccatagacgggtgcaccacccacatg
gagaacttggccgagaagtctgagctgcctgtggtggacgagaccacaactcttctcaac
gagcgtaactccttgctgcacaaagcctcccacgagaatgccatctga

DBGET integrated database retrieval system