KEGG   Homo sapiens (human): 26505
Entry
26505             CDS       T01001                                 

Symbol
CNNM3, ACDP3
Name
(RefSeq) cyclin and CBS domain divalent metal cation transport mediator 3
  KO
K16302  metal transporter CNNM
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    26505 (CNNM3)
Transporters [BR:hsa02000]
 Other transporters
  Others
   26505 (CNNM3)
SSDB
Motif
Pfam: CBS DUF21 cNMP_binding
Other DBs
NCBI-GeneID: 26505
NCBI-ProteinID: NP_060093
OMIM: 607804
HGNC: 104
Ensembl: ENSG00000168763
Vega: OTTHUMG00000130531
Pharos: Q8NE01(Tbio)
UniProt: Q8NE01
Structure
PDB: 

Position
2q11.2
AA seq 707 aa
MAAAVAAAGRLGWLFAALCLGNAAGEAAPGPRVLGFCLEEDGAAGAGWVRGGAARDTPDA
TFLLRLFGPGFANSSWSWVAPEGAGCREEAASPAGEWRALLRLRLRAEAVRPHSALLAVR
VEPGGGAAEEAAPPWALGLGAAGLLALAALARGLQLSALALAPAEVQVLRESGSEAERAA
ARRLEPARRWAGCALGALLLLASLAQAALAVLLYRAAGQRAVPAVLGSAGLVFLVGEVVP
AAVSGRWTLALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARGGGDP
YSDLSKGVLRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIV
DMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVN
NEGEGDPFYEVLGLVTLEDVIEEIIRSEILDESEDYRDTVVKRKPASLMAPLKRKEEFSL
FKVSDDEYKVTISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVRFDESN
RLATHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTVPSSVHQSP
VSSLQPIRHDLQPDPGDGTHSSAYCPDYTVRALSDLQLIKVTRLQYLNALLATRAQNLPQ
SPENTDLQVIPGSQTRLLGEKTTTAAGSSHSRPGVPVEGSPGRNPGV
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggcggcggcggtagctgcggcgggtcggttaggctggttgttcgccgcgctctgcctg
ggcaacgccgcgggggaggccgcgccgggcccgcgagtgctgggcttctgcctggaggag
gatggagcggcgggcgcgggttgggtacgcggaggggcggcgcgggacacgccggacgcc
accttcctcctgcgcctcttcggcccgggcttcgccaacagctcttggtcctgggtggcc
ccggagggggcgggctgccgggaggaggcggcctcccccgcgggcgagtggcgcgcgctg
ctgcgcttgcgcctgcgggccgaggccgtgcgcccgcactcggcgctgctggcggtgcgc
gtggagccgggtggcggggcggctgaggaggcggcgccgccctgggctctgggcctgggg
gcggccgggctgctggcgctggcagcgctggcgcgaggcctgcagctgagcgcgctggcg
ctggcgcctgccgaggtgcaggtgctgcgcgagagcggctcggaggcggagcgtgcggcg
gcgcggcgtttggagcccgcgcggcgctgggccggctgcgccttgggcgcgctgctgctg
ctggccagcctggcgcaggcggcgctggcggtgctgctgtaccgcgcggccggccagcgt
gcggtgcccgccgtgttgggcagcgcggggctcgtgttcctggtgggagaggtggtgccg
gccgccgtgagcgggcgctggacgctggcgctggcgccgcgagcgctcggcctcagccgc
ctggccgtcctgctcactctgcccgtcgcgctgcccgtggggcagctgctggagctggcg
gcgcggcccgggcggctgcgggagcgggtgctggagctggcgcgcggcggcggcgacccc
tacagcgatctcagcaagggcgtgctgcgctgccggaccgtggaggacgtgctcacgccc
ctcgaagactgcttcatgctggacgccagcaccgtgctggacttcggcgtcctggccagc
atcatgcagagcggccacacgcgcatcccggtgtacgaggaggagcgctccaacatcgtg
gacatgctctacctcaaggacttggccttcgtggatcccgaagactgcacgccgctcagc
accatcactcgtttctacaaccatccgctccacttcgtcttcaacgacaccaagctggac
gctgtcctggaggaattcaagcgagggaagtcccacctggccatcgtgcagaaggtgaac
aacgagggtgaaggcgaccccttctacgaggtcctgggcctggtcaccctggaggacgtg
atcgaggagatcatcaggtccgagatcctggacgagtctgaagactaccgagacaccgtg
gtgaagaggaagcctgcttctctgatggcccctctgaagcggaaggaggagttctccttg
ttcaaggtgtctgatgatgaatataaagtaacaatctcgcctcagctgctcttggccacc
cagcgcttcctgtcccgagaagtggatgtattcagcccgctgcgcatctctgagaaggtc
ctgctgcacctgttgaagcatcccagtgtcaaccaggaagtgaggtttgacgagagcaac
cggctggccacacaccactacctgtaccagcgcagccagccggtggattacttcattctc
atcctgcagggcagggttgaagtggagatcgggaaagagggtctgaagtttgagaatggg
gccttcacgtactatggagtgtcggccctaactgtgccatcctcggttcaccagtccccg
gtgtcctcgctccagcccatccgccatgacctgcagcccgacccaggtgacggcacgcat
tcatctgcgtattgtcccgactacaccgtgagggcgctctctgatctgcagctcatcaag
gttacgcgactgcagtacctcaatgcactcctggctacccgagcccagaacctgccacag
tcccctgagaacaccgacctgcaggttattccaggcagccagaccaggctccttggtgag
aagaccaccacagcggcagggtccagccacagcaggcccggcgtcccggtggaaggcagc
cctgggcggaacccaggcgtttaa

DBGET integrated database retrieval system