KEGG   Homo sapiens (human): 26520Help
Entry
26520             CDS       T01001                                 

Gene name
TIMM9, TIM9, TIM9A
Definition
(RefSeq) translocase of inner mitochondrial membrane 9
  KO
K17777  mitochondrial import inner membrane translocase subunit TIM9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    26520 (TIMM9)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    26520 (TIMM9)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Transporter inner membrane (TIM) 9/10 complex
    26520 (TIMM9)
Transporters [BR:hsa02000]
 Other Transporters
  Primary active transporters [TC:3]
   26520 (TIMM9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Tim10_DDP DUF2116
Motif
Other DBs
NCBI-GeneID: 26520
NCBI-ProteinID: NP_001291414
OMIM: 607384
HGNC: 11819
Ensembl: ENSG00000100575
Vega: OTTHUMG00000140322
Pharos: Q9Y5J7(Tbio)
UniProt: Q9Y5J7 A0A024R648
Structure
PDB: 

Position
14q23.1
AA seq 89 aa AA seqDB search
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMT
QRISMRFQEYHIQQNEALAAKAGLLGQPR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacaaataccagaatctgatcagataaaacagtttaaggaatttctggggacc
tacaataaacttacagagacctgctttttggactgtgttaaagacttcacaacaagagaa
gtaaaacctgaagagaccacctgttcagaacattgcttacagaaatatttaaaaatgaca
caaagaatatccatgagatttcaggaatatcatattcagcagaatgaagccctggcagcc
aaagcaggactccttggccaaccacgatag

DBGET integrated database retrieval system