KEGG   Homo sapiens (human): 26523Help
Entry
26523             CDS       T01001                                 

Gene name
AGO1, EIF2C, EIF2C1, GERP95, Q99, hAgo1
Definition
(RefSeq) argonaute RISC component 1
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    26523 (AGO1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    26523 (AGO1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     26523 (AGO1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    26523 (AGO1)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     26523 (AGO1)
   microRNA pathway
    RISC loading complex
     26523 (AGO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi ArgoMid PAZ ArgoN ArgoL1 ArgoL2
Motif
Other DBs
NCBI-GeneID: 26523
NCBI-ProteinID: NP_036331
OMIM: 606228
HGNC: 3262
Ensembl: ENSG00000092847
Vega: OTTHUMG00000007381
Pharos: Q9UL18(Tbio)
UniProt: Q9UL18 B2RAD8
Structure
PDB: 

Position
1p34.3
AA seq 857 aa AA seqDB search
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIK
PDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGE
GKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF
SPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRN
IDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTS
TMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAG
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGM
ATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPP
AGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPT
RIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNE
RIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQIL
TYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQAL
AKAVQVHQDTLRTMYFA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgggaccctcgggagcagctgcgggcgcttacctgccccccctgcagcaggtg
ttccaggcacctcgccggcctggcattggcactgtggggaaaccaatcaagctcctggcc
aattactttgaggtggacatccctaagatcgacgtgtaccactacgaggtggacatcaag
ccggataagtgtccccgtagagtcaaccgggaagtggtggaatacatggtccagcatttc
aagcctcagatctttggtgatcgcaagcctgtgtatgatggaaagaagaacatttacact
gtcacagcactgcccattggcaacgaacgggtcgactttgaggtgacaatccctggggaa
gggaaggatcgaatctttaaggtctccatcaagtggctagccattgtgagctggcgaatg
ctgcatgaggccctggtcagcggccagatccctgttcccttggagtctgtgcaagccctg
gatgtggccatgaggcacctggcatccatgaggtacacccctgtgggccgctccttcttc
tcaccgcctgagggctactaccacccgctggggggtgggcgcgaggtctggttcggcttt
caccagtctgtgcgccctgccatgtggaagatgatgctcaacattgatgtctcagccact
gccttttataaggcacagccagtgattgagttcatgtgtgaggtgctggacatcaggaac
atagatgagcagcccaagcccctcacggactctcagcgcgttcgcttcaccaaggagatc
aagggcctgaaggtggaagtcacccactgtggacagatgaagaggaagtaccgcgtgtgt
aatgttacccgtcgccctgctagccatcagacattccccttacagctggagagtggacag
actgtggagtgcacagtggcacagtatttcaagcagaaatataaccttcagctcaagtat
ccccatctgccctgcctacaagttggccaggaacaaaagcatacctaccttcccctagag
gtctgtaacattgtggctgggcagcgctgtattaaaaagctgaccgacaaccagacctcg
accatgataaaggccacagctagatccgctccagacagacaggaggagatcagtcgcctg
atgaagaatgccagctacaacttagatccctacatccaggaatttgggatcaaagtgaag
gatgacatgacggaggtgacagggcgagtgctgccggcgcccatcttgcagtacggcggc
cggaaccgggccattgccacacccaatcagggtgtctgggacatgcgggggaaacagttc
tacaatgggattgagatcaaagtctgggccatcgcctgcttcgcaccccaaaaacagtgt
cgagaagaggtgctcaagaacttcacagaccagctgcggaagatttccaaggatgcgggg
atgcctatccagggtcaaccttgtttctgcaaatatgcacagggggcagacagcgtggag
cctatgttccggcatctcaagaacacctactcagggctgcagctcattattgtcatcctg
ccagggaagacgccggtgtatgctgaggtgaaacgtgtcggagatacactcttgggaatg
gctacgcagtgtgtgcaggtgaagaacgtggtcaagacctcacctcagactctgtccaac
ctctgcctcaagatcaatgtcaaacttggtggcattaacaacatcctagtcccacaccag
cgctctgccgtttttcaacagccagtgatattcctgggagcagatgttacacacccccca
gcaggggatgggaaaaaaccttctatcacagcagtggtaggcagtatggatgcccacccc
agccgatactgtgctactgtgcgggtacagcgaccacggcaagagatcattgaagacttg
tcctacatggtgcgtgagctcctcatccaattctacaagtccacccgtttcaagcctacc
cgcatcatcttctaccgagatggggtgcctgaaggccagctaccccagatactccactat
gagctactggccattcgtgatgcctgcatcaaactggaaaaggactaccagcctgggatc
acttatattgtggtgcagaaacgccatcacacccgccttttctgtgctgacaagaatgag
cgaattgggaagagtggtaacatcccagctgggaccacagtggacaccaacatcacccac
ccatttgagtttgacttctatctgtgcagccacgcaggcatccagggcaccagccgacca
tcccattactatgttctttgggatgacaaccgtttcacagcagatgagctccagatcctg
acgtaccagctgtgccacacttacgtacgatgcacacgctctgtctctatcccagcacct
gcctactatgcccgcctggtggctttccgggcacgataccacctggtggacaaggagcat
gacagtggagaggggagccacatatcggggcagagcaatgggcgggacccccaggccctg
gccaaagccgtgcaggttcaccaggatactctgcgcaccatgtacttcgcttga

DBGET integrated database retrieval system